CD300C blocking peptide
CD300C Peptide - C-terminal region
Gene Names
CD300C; LIR; CLM-6; CMRF35; IGSF16; CMRF-35; CMRF35A; CMRF-35A; CMRF35A1; CMRF35-A1
Reactivity
Human
Applications
Western Blot
Synonyms
CD300C; CD300C Peptide - C-terminal region; CD300C blocking peptide
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
MGTSGPPTKLPVHTWPSVTRKDSPEPSPHPGSLFSNVRFLLLVLLELPLL
Sequence Length
224
Applicable Applications for CD300C blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for CD300C blocking peptide
This is a synthetic peptide designed for use in combination with anti-CD300C Antibody, made
Target Description: The CMRF35 antigen, which was identified by reactivity with a monoclonal antibody, is present on monocytes, neutrophils, and some T and B lymphocytes.
Target Description: The CMRF35 antigen, which was identified by reactivity with a monoclonal antibody, is present on monocytes, neutrophils, and some T and B lymphocytes.
Product Categories/Family for CD300C blocking peptide
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
23kDa
NCBI Official Full Name
CMRF35-like molecule 6
NCBI Official Synonym Full Names
CD300c molecule
NCBI Official Symbol
CD300C
NCBI Official Synonym Symbols
LIR; CLM-6; CMRF35; IGSF16; CMRF-35; CMRF35A; CMRF-35A; CMRF35A1; CMRF35-A1
NCBI Protein Information
CMRF35-like molecule 6
UniProt Protein Name
CMRF35-like molecule 6
Protein Family
UniProt Gene Name
CD300C
UniProt Synonym Gene Names
CMRF35; CMRF35A; CMRF35A1; IGSF16; CLM-6; CMRF-35; IgSF16
UniProt Entry Name
CLM6_HUMAN
NCBI Description
The CMRF35 antigen, which was identified by reactivity with a monoclonal antibody, is present on monocytes, neutrophils, and some T and B lymphocytes (Jackson et al., 1992 [PubMed 1349532]).[supplied by OMIM, Mar 2008]
Uniprot Description
CD300C: Belongs to the CD300 family
Protein type: Membrane protein, integral
Chromosomal Location of Human Ortholog: 17q25.1
Cellular Component: integral to plasma membrane
Molecular Function: transmembrane receptor activity
Biological Process: immune system process; cellular defense response; signal transduction
Research Articles on CD300C
Similar Products
Product Notes
The CD300C cd300c (Catalog #AAA3241593) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The CD300C Peptide - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CD300C can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CD300C cd300c for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MGTSGPPTKL PVHTWPSVTR KDSPEPSPHP GSLFSNVRFL LLVLLELPLL. It is sometimes possible for the material contained within the vial of "CD300C, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
