CD274 blocking peptide

CD274 Peptide - N-terminal region

Cat. Num. AAA3240885

• Gene Names: CD274; B7-H; B7H1; PDL1; PD-L1; PDCD1L1; PDCD1LG1
• Reactivity: Human
• Synonyms: CD274; CD274 Peptide - N-terminal region; CD274 blocking peptide

• Reactivity: Human
• Form/Format: Lyophilized powder
• Sequence: HLVILGAILLCLGVALTFIFRLRKGRMMDVKKCGIQDTNSKKQSDTHLEE
• Sequence Length: 290

• Preparation and Storage: Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.

Related Product Information for CD274 blocking peptide

This is a synthetic peptide designed for use in combination with anti-CD274 Antibody, made

Target Description: CD274 is involved in the costimulatory signal, essential for T-cell proliferation and production of IL10 and IFNG, in an IL2-dependent and a PDCD1-independent manner. Interaction with PDCD1 inhibits T-cell proliferation and cytokine production.

Product Categories/Family for CD274 blocking peptide

Peptide

NCBI and Uniprot Product Information

• NCBI GI #: 7661534
• NCBI GeneID: 29126
• NCBI Accession #: NP_054862
• NCBI GenBank Nucleotide #: NM_014143
• UniProt Accession #: Q9NZQ7
• Molecular Weight: 32kDa
• NCBI Official Full Name: programmed cell death 1 ligand 1 isoform a
• NCBI Official Synonym Full Names: CD274 molecule
• NCBI Official Symbol: CD274
• NCBI Official Synonym Symbols: B7-H; B7H1; PDL1; PD-L1; PDCD1L1; PDCD1LG1
• NCBI Protein Information: programmed cell death 1 ligand 1
• UniProt Protein Name: Programmed cell death 1 ligand 1
• Protein Family: Programmed cell death
• UniProt Gene Name: CD274
• UniProt Synonym Gene Names: B7H1; PDCD1L1; PDCD1LG1; PDL1; PD-L1; PDCD1 ligand 1; Programmed death ligand 1; B7-H1
• UniProt Entry Name: PD1L1_HUMAN

NCBI Description

This gene encodes an immune inhibitory receptor ligand that is expressed by hematopoietic and non-hematopoietic cells, such as T cells and B cells and various types of tumor cells. The encoded protein is a type I transmembrane protein that has immunoglobulin V-like and C-like domains. Interaction of this ligand with its receptor inhibits T-cell activation and cytokine production. During infection or inflammation of normal tissue, this interaction is important for preventing autoimmunity by maintaining homeostasis of the immune response. In tumor microenvironments, this interaction provides an immune escape for tumor cells through cytotoxic T-cell inactivation. Expression of this gene in tumor cells is considered to be prognostic in many types of human malignancies, including colon cancer and renal cell carcinoma. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Sep 2015]

Uniprot Description

CD274: Involved in the costimulatory signal, essential for T- cell proliferation and production of IL10 and IFNG, in an IL2- dependent and a PDCD1-independent manner. Interaction with PDCD1 inhibits T-cell proliferation and cytokine production. Belongs to the immunoglobulin superfamily. BTN/MOG family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral

Chromosomal Location of Human Ortholog: 9p24

Cellular Component: plasma membrane; integral to membrane; endomembrane system; external side of plasma membrane

Molecular Function: protein binding

Biological Process: regulation of activated T cell proliferation; cell surface receptor linked signal transduction; negative regulation of interleukin-10 production; negative regulation of interferon-gamma production; negative regulation of activated T cell proliferation; T cell costimulation; immune response; positive regulation of T cell proliferation; signal transduction