Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

CD247 blocking peptide

CD247 Peptide - middle region

Gene Names
CD247; T3Z; CD3H; CD3Q; CD3Z; TCRZ; IMD25; CD3-ZETA
Reactivity
Human
Synonyms
CD247; CD247 Peptide - middle region; CD247 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: DAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPQRRKNPQEG
Sequence Length
164
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for CD247 blocking peptide
The protein encoded by this gene is T-cell receptor zeta, which together with T-cell receptor alpha/beta and gamma/delta heterodimers, and with CD3-gamma, -delta and -epsilon, forms the T-cell receptor-CD3 complex. The zeta chain plays an important role in coupling antigen recognition to several intracellular signal-transduction pathways. Low expression of the antigen results in impaired immune response. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.
Product Categories/Family for CD247 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
919
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
18kDa
NCBI Official Full Name
T-cell surface glycoprotein CD3 zeta chain isoform 1
NCBI Official Synonym Full Names
CD247 molecule
NCBI Official Symbol
CD247
NCBI Official Synonym Symbols
T3Z; CD3H; CD3Q; CD3Z; TCRZ; IMD25; CD3-ZETA
NCBI Protein Information
T-cell surface glycoprotein CD3 zeta chain
UniProt Protein Name
T-cell surface glycoprotein CD3 zeta chain
UniProt Gene Name
CD247
UniProt Synonym Gene Names
CD3Z; T3Z; TCRZ
UniProt Entry Name
CD3Z_HUMAN

NCBI Description

The protein encoded by this gene is T-cell receptor zeta, which together with T-cell receptor alpha/beta and gamma/delta heterodimers, and with CD3-gamma, -delta and -epsilon, forms the T-cell receptor-CD3 complex. The zeta chain plays an important role in coupling antigen recognition to several intracellular signal-transduction pathways. Low expression of the antigen results in impaired immune response. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

CD3Z: a T cell surface glycoprotein that is a component of the T cell antigen receptor. Plays an important role in coupling antigen recognition to several intracellular signal-transduction pathways. Low expression of the CD3-epsilon results in impaired immune response. Two alternatively spliced isoforms have been described.

Protein type: Receptor, misc.; Membrane protein, integral

Chromosomal Location of Human Ortholog: 1q24.2

Cellular Component: T cell receptor complex; cytoplasm; plasma membrane; integral to membrane; alpha-beta T cell receptor complex

Molecular Function: identical protein binding; protein binding; protein homodimerization activity; transmembrane receptor activity

Biological Process: regulation of immune response; viral reproduction; T cell costimulation; innate immune response; T cell receptor signaling pathway; regulation of defense response to virus by virus

Disease: Immunodeficiency 25

Research Articles on CD247

Similar Products

Product Notes

The CD247 cd247 (Catalog #AAA3245017) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The CD247 Peptide - middle region reacts with Human and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: Synthetic peptide located within the following region: DAPAYQQGQN QLYNELNLGR REEYDVLDKR RGRDPEMGGK PQRRKNPQEG. It is sometimes possible for the material contained within the vial of "CD247, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.