Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of CD247 expression in transfected 293T cell line by CD247 polyclonal antibody. Lane 1: CD247 transfected lysate (18.7kD). Lane 2: Non-transfected lysate.)

Rabbit CD247 Polyclonal Antibody | anti-CD247 antibody

CD247 (T-cell Surface Glycoprotein CD3 zeta Chain, T-cell Receptor T3 zeta Chain, CD3Z, T3Z, TCRZ) (Biotin)

Gene Names
CD247; T3Z; CD3H; CD3Q; CD3Z; TCRZ; IMD25; CD3-ZETA
Reactivity
Human, Mouse, Rat
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
CD247; Polyclonal Antibody; CD247 (T-cell Surface Glycoprotein CD3 zeta Chain; T-cell Receptor T3 zeta Chain; CD3Z; T3Z; TCRZ) (Biotin); anti-CD247 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human CD247. Species Crossreactivity: mouse and rat.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-CD247 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human CD247, aa1-164 (NP_932170.1).
Immunogen Sequence
MKWKALFTAAILQAQLPITEAQSFGLLDPKLCYLLDGILFIYGVILTALFLRVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPQRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPR
Conjugate
Biotin
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of CD247 expression in transfected 293T cell line by CD247 polyclonal antibody. Lane 1: CD247 transfected lysate (18.7kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of CD247 expression in transfected 293T cell line by CD247 polyclonal antibody. Lane 1: CD247 transfected lysate (18.7kD). Lane 2: Non-transfected lysate.)

Testing Data

(Proximity Ligation Analysis (PLA) of protein-protein interactions between CD247 and CD3E. HeLa cells were stained with CD247 rabbit purified polyclonal 1:1200 and CD3E mouse monoclonal antibody 1:50. Signals were detected by 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)

Testing Data (Proximity Ligation Analysis (PLA) of protein-protein interactions between CD247 and CD3E. HeLa cells were stained with CD247 rabbit purified polyclonal 1:1200 and CD3E mouse monoclonal antibody 1:50. Signals were detected by 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)
Related Product Information for anti-CD247 antibody
T-cell receptor zeta, together with T-cell receptor alpha/beta and gamma/delta heterodimers and CD3-gamma,-delta, and-epsilon, forms the T-cell receptor-CD3 complex. The zeta chain plays an important role in coupling antigen recognition to several intracellular signal-transduction pathways. Low expression of the antigen results in impaired immune response.
Product Categories/Family for anti-CD247 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
919
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
– Da
NCBI Official Full Name
T-cell surface glycoprotein CD3 zeta chain isoform 1
NCBI Official Synonym Full Names
CD247 molecule
NCBI Official Symbol
CD247
NCBI Official Synonym Symbols
T3Z; CD3H; CD3Q; CD3Z; TCRZ; IMD25; CD3-ZETA
NCBI Protein Information
T-cell surface glycoprotein CD3 zeta chain
UniProt Protein Name
T-cell surface glycoprotein CD3 zeta chain
UniProt Gene Name
CD247
UniProt Synonym Gene Names
CD3Z; T3Z; TCRZ
UniProt Entry Name
CD3Z_HUMAN

NCBI Description

The protein encoded by this gene is T-cell receptor zeta, which together with T-cell receptor alpha/beta and gamma/delta heterodimers, and with CD3-gamma, -delta and -epsilon, forms the T-cell receptor-CD3 complex. The zeta chain plays an important role in coupling antigen recognition to several intracellular signal-transduction pathways. Low expression of the antigen results in impaired immune response. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

CD3Z: a T cell surface glycoprotein that is a component of the T cell antigen receptor. Plays an important role in coupling antigen recognition to several intracellular signal-transduction pathways. Low expression of the CD3-epsilon results in impaired immune response. Two alternatively spliced isoforms have been described.

Protein type: Receptor, misc.; Membrane protein, integral

Chromosomal Location of Human Ortholog: 1q24.2

Cellular Component: T cell receptor complex; cytoplasm; plasma membrane; integral to membrane; alpha-beta T cell receptor complex

Molecular Function: identical protein binding; protein binding; protein homodimerization activity; transmembrane receptor activity

Biological Process: regulation of immune response; viral reproduction; T cell costimulation; innate immune response; T cell receptor signaling pathway; regulation of defense response to virus by virus

Disease: Immunodeficiency 25

Research Articles on CD247

Similar Products

Product Notes

The CD247 cd247 (Catalog #AAA6372973) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CD247 (T-cell Surface Glycoprotein CD3 zeta Chain, T-cell Receptor T3 zeta Chain, CD3Z, T3Z, TCRZ) (Biotin) reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's CD247 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CD247 cd247 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CD247, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.