Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

CAPNS2 blocking peptide

CAPNS2 Peptide - middle region

Gene Names
CAPNS2; CSS2
Reactivity
Human
Applications
Western Blot
Synonyms
CAPNS2; CAPNS2 Peptide - middle region; CAPNS2 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: IKKWQCVYKQYDRDHSGSLGSSQLRGALQAAGFQLNEQLYQMIVRRYANE
Sequence Length
248
Applicable Applications for CAPNS2 blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for CAPNS2 blocking peptide
This is a synthetic peptide designed for use in combination with anti-CAPNS2 Antibody, made
Product Categories/Family for CAPNS2 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
27 kDa
NCBI Official Full Name
calpain small subunit 2
NCBI Official Synonym Full Names
calpain small subunit 2
NCBI Official Symbol
CAPNS2
NCBI Official Synonym Symbols
CSS2
NCBI Protein Information
calpain small subunit 2
UniProt Protein Name
Calpain small subunit 2
Protein Family
UniProt Gene Name
CAPNS2
UniProt Synonym Gene Names
CSS2
UniProt Entry Name
CPNS2_HUMAN

Uniprot Description

CAPNS2: Calcium-regulated non-lysosomal thiol-protease which catalyzes limited proteolysis of substrates involved in cytoskeletal remodeling and signal transduction. This small subunit may act as a tissue-specific chaperone of the large subunit, possibly by helping it fold into its correct conformation for activity.

Chromosomal Location of Human Ortholog: 16q12.2

Cellular Component: cytoplasm; plasma membrane

Molecular Function: calcium-dependent cysteine-type endopeptidase activity; calcium ion binding

Biological Process: proteolysis

Research Articles on CAPNS2

Similar Products

Product Notes

The CAPNS2 capns2 (Catalog #AAA3239720) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The CAPNS2 Peptide - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CAPNS2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CAPNS2 capns2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: IKKWQCVYKQ YDRDHSGSLG SSQLRGALQA AGFQLNEQLY QMIVRRYANE. It is sometimes possible for the material contained within the vial of "CAPNS2, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.