Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

CABS1 blocking peptide

CABS1 Peptide - N-terminal region

Gene Names
CABS1; CLPH; C4orf35; NYD-SP26
Reactivity
Human
Applications
Western Blot
Synonyms
CABS1; CABS1 Peptide - N-terminal region; CABS1 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
TTITSEGDHVTSVNEYMLESDFSTTTDNKLTAKKEKLKSEDDMGTDFIKS
Sequence Length
395
Applicable Applications for CABS1 blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for CABS1 blocking peptide
This is a synthetic peptide designed for use in combination with anti-CABS1 Antibody, made

Target Description: The function of this protein remains unknown.
Product Categories/Family for CABS1 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
43kDa
NCBI Official Full Name
calcium-binding and spermatid-specific protein 1
NCBI Official Synonym Full Names
calcium binding protein, spermatid associated 1
NCBI Official Symbol
CABS1
NCBI Official Synonym Symbols
CLPH; C4orf35; NYD-SP26
NCBI Protein Information
calcium-binding and spermatid-specific protein 1
UniProt Protein Name
Calcium-binding and spermatid-specific protein 1
UniProt Gene Name
CABS1
UniProt Synonym Gene Names
C4orf35
UniProt Entry Name
CABS1_HUMAN

Uniprot Description

CLPH:

Protein type: Calcium-binding; Mitochondrial

Chromosomal Location of Human Ortholog: 4q13.3

Cellular Component: mitochondrial inner membrane

Molecular Function: calcium ion binding

Biological Process: spermatogenesis

Research Articles on CABS1

Similar Products

Product Notes

The CABS1 cabs1 (Catalog #AAA3242636) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The CABS1 Peptide - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CABS1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CABS1 cabs1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: TTITSEGDHV TSVNEYMLES DFSTTTDNKL TAKKEKLKSE DDMGTDFIKS. It is sometimes possible for the material contained within the vial of "CABS1, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.