BNIPL blocking peptide
BNIPL Peptide - C-terminal region
Gene Names
BNIPL; BNIPS; PP753; BNIP-S; BNIPL1; BNIPL2; BNIPL-1; BNIPL-2; BNIP-Sbeta; BNIP-Salpha
Reactivity
Human
Applications
Western Blot
Synonyms
BNIPL; BNIPL Peptide - C-terminal region; BNIPL blocking peptide
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: WIRQCYRTLDRRLRKNLRALVVVHATWYVKAFLALLRPFISSKFTRKIRF
Sequence Length
275
Applicable Applications for BNIPL blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for BNIPL blocking peptide
This is a synthetic peptide designed for use in combination with anti-BNIPL Antibody, made
Target Description: The protein encoded by this gene interacts with several other proteins, such as BCL2, ARHGAP1, MIF and GFER. It may function as a bridge molecule between BCL2 and ARHGAP1/CDC42 in promoting cell death. Alternatively spliced transcript variants encoding different isoforms have been described for this gene.
Target Description: The protein encoded by this gene interacts with several other proteins, such as BCL2, ARHGAP1, MIF and GFER. It may function as a bridge molecule between BCL2 and ARHGAP1/CDC42 in promoting cell death. Alternatively spliced transcript variants encoding different isoforms have been described for this gene.
Product Categories/Family for BNIPL blocking peptide
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
30 kDa
NCBI Official Full Name
bcl-2/adenovirus E1B 19 kDa-interacting protein 2-like protein isoform b
NCBI Official Synonym Full Names
BCL2 interacting protein like
NCBI Official Symbol
BNIPL
NCBI Official Synonym Symbols
BNIPS; PP753; BNIP-S; BNIPL1; BNIPL2; BNIPL-1; BNIPL-2; BNIP-Sbeta; BNIP-Salpha
NCBI Protein Information
bcl-2/adenovirus E1B 19 kDa-interacting protein 2-like protein
UniProt Protein Name
Bcl-2/adenovirus E1B 19 kDa-interacting protein 2-like protein
UniProt Gene Name
BNIPL
UniProt Entry Name
BNIPL_HUMAN
NCBI Description
The protein encoded by this gene interacts with several other proteins, such as BCL2, ARHGAP1, MIF and GFER. It may function as a bridge molecule between BCL2 and ARHGAP1/CDC42 in promoting cell death. Alternatively spliced transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq, Aug 2011]
Uniprot Description
BNIPL: May be a bridge molecule between BCL2 and ARHGAP1/CDC42 in promoting cell death. 3 isoforms of the human protein are produced by alternative splicing.
Chromosomal Location of Human Ortholog: 1q21.3
Cellular Component: nucleus; cytosol
Molecular Function: identical protein binding; protein binding
Biological Process: negative regulation of cell proliferation; apoptosis; regulation of growth rate
Research Articles on BNIPL
Similar Products
Product Notes
The BNIPL bnipl (Catalog #AAA3235812) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The BNIPL Peptide - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's BNIPL can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the BNIPL bnipl for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: WIRQCYRTLD RRLRKNLRAL VVVHATWYVK AFLALLRPFI SSKFTRKIRF. It is sometimes possible for the material contained within the vial of "BNIPL, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
