Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

BNIP1 blocking peptide

BNIP1 Peptide - C-terminal region

Gene Names
BNIP1; NIP1; SEC20; TRG-8
Reactivity
Human
Applications
Western Blot
Synonyms
BNIP1; BNIP1 Peptide - C-terminal region; BNIP1 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
QSLVTSSRTILDANEEFKSMSGTIQLGRKLITKYNRRELTDKLLIFLALA
Sequence Length
228
Applicable Applications for BNIP1 blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for BNIP1 blocking peptide
This is a synthetic peptide designed for use in combination with anti-BNIP1 Antibody, made

Target Description: This gene is a member of the BCL2/adenovirus E1B 19 kd-interacting protein (BNIP) family. It interacts with the E1B 19 kDa protein which is responsible for the protection of virally-induced cell death, as well as E1B 19 kDa-like sequences of BCL2, also an apoptotic protector. Alternative splicing of this gene results in four protein products with identical N- and C-termini.
Product Categories/Family for BNIP1 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
662
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
26kDa
NCBI Official Full Name
Vesicle transport protein SEC20
NCBI Official Synonym Full Names
BCL2 interacting protein 1
NCBI Official Symbol
BNIP1
NCBI Official Synonym Symbols
NIP1; SEC20; TRG-8
NCBI Protein Information
vesicle transport protein SEC20
UniProt Protein Name
Vesicle transport protein SEC20
Protein Family
UniProt Gene Name
BNIP1
UniProt Synonym Gene Names
NIP1; SEC20L; TRG-8
UniProt Entry Name
SEC20_HUMAN

NCBI Description

This gene is a member of the BCL2/adenovirus E1B 19 kd-interacting protein (BNIP) family. It interacts with the E1B 19 kDa protein, which protects cells from virally-induced cell death. The encoded protein also interacts with E1B 19 kDa-like sequences of BCL2, another apoptotic protector. In addition, this protein is involved in vesicle transport into the endoplasmic reticulum. Alternative splicing of this gene results in four protein products with identical N- and C-termini. [provided by RefSeq, Mar 2011]

Uniprot Description

BNIP1: SNARE that may be involved in targeting and fusion of Golgi-derived retrograde transport vesicles with the ER. Required for maintenance of ER network. Implicated in the suppression of cell death. May be involved in mitochondrial autophagy. Belongs to the SEC20 family. 4 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral; Apoptosis

Chromosomal Location of Human Ortholog: 5q33-q34

Cellular Component: SNARE complex; mitochondrion; intracellular membrane-bound organelle; endoplasmic reticulum; cytoplasm; integral to endoplasmic reticulum membrane; nuclear envelope

Molecular Function: SNAP receptor activity; protein binding

Biological Process: endoplasmic reticulum organization and biogenesis; endoplasmic reticulum membrane fusion; vesicle-mediated transport; apoptosis; autophagy; negative regulation of apoptosis

Research Articles on BNIP1

Similar Products

Product Notes

The BNIP1 bnip1 (Catalog #AAA3239312) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The BNIP1 Peptide - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's BNIP1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the BNIP1 bnip1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: QSLVTSSRTI LDANEEFKSM SGTIQLGRKL ITKYNRRELT DKLLIFLALA. It is sometimes possible for the material contained within the vial of "BNIP1, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.