Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

AVPR1A blocking peptide

AVPR1A Peptide - C-terminal region

Gene Names
AVPR1A; V1aR; AVPR1; AVPR V1a
Reactivity
Human
Applications
Western Blot
Synonyms
AVPR1A; AVPR1A Peptide - C-terminal region; AVPR1A blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
PCCQNMKEKFNKEDTDSMSRRQTFYSNNRSPTNSTGMWKDSPKSSKSIKF
Sequence Length
418
Applicable Applications for AVPR1A blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for AVPR1A blocking peptide
This is a synthetic peptide designed for use in combination with anti-AVPR1A Antibody, made

Target Description: The protein encoded by this gene acts as receptor for arginine vasopressin. This receptor belongs to the subfamily of G-protein coupled receptors which includes AVPR1B, V2R and OXT receptors. Its activity is mediated by G proteins which stimulate a phosphatidylinositol-calcium second messenger system. The receptor mediates cell contraction and proliferation, platelet aggregation, release of coagulation factor and glycogenolysis.
Product Categories/Family for AVPR1A blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
552
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
46kDa
NCBI Official Full Name
vasopressin V1a receptor
NCBI Official Synonym Full Names
arginine vasopressin receptor 1A
NCBI Official Symbol
AVPR1A
NCBI Official Synonym Symbols
V1aR; AVPR1; AVPR V1a
NCBI Protein Information
vasopressin V1a receptor
UniProt Protein Name
Vasopressin V1a receptor
Protein Family
UniProt Gene Name
AVPR1A
UniProt Synonym Gene Names
AVPR1; V1aR
UniProt Entry Name
V1AR_HUMAN

NCBI Description

The protein encoded by this gene acts as receptor for arginine vasopressin. This receptor belongs to the subfamily of G-protein coupled receptors which includes AVPR1B, V2R and OXT receptors. Its activity is mediated by G proteins which stimulate a phosphatidylinositol-calcium second messenger system. The receptor mediates cell contraction and proliferation, platelet aggregation, release of coagulation factor and glycogenolysis. [provided by RefSeq, Jul 2008]

Uniprot Description

AVPR1A: Receptor for arginine vasopressin. The activity of this receptor is mediated by G proteins which activate a phosphatidyl- inositol-calcium second messenger system. Has been involved in social behaviors, including affiliation and attachment. Belongs to the G-protein coupled receptor 1 family. Vasopressin/oxytocin receptor subfamily.

Protein type: Membrane protein, integral; GPCR, family 1; Membrane protein, multi-pass; Receptor, GPCR

Chromosomal Location of Human Ortholog: 12q14-q15

Cellular Component: integral to plasma membrane; plasma membrane; cytoplasmic vesicle; endosome

Molecular Function: protein binding; protein kinase C binding; V1A vasopressin receptor binding; peptide hormone binding; peptide binding; vasopressin receptor activity

Biological Process: blood circulation; positive regulation of glutamate secretion; positive regulation of cellular pH reduction; positive regulation of systemic arterial blood pressure; cellular response to water deprivation; elevation of cytosolic calcium ion concentration; positive regulation of cell proliferation; response to corticosterone stimulus; penile erection; positive regulation of prostaglandin biosynthetic process; grooming behavior; generation of precursor metabolites and energy; maternal behavior; myotube differentiation; calcium-mediated signaling; positive regulation of heart rate; social behavior; positive regulation of cell growth; cellular response to hormone stimulus; negative regulation of female receptivity; G-protein coupled receptor protein signaling pathway; telencephalon development; negative regulation of transmission of nerve impulse; regulation of systemic arterial blood pressure by vasopressin; phospholipase C activation; positive regulation of vasoconstriction; sperm ejaculation

Research Articles on AVPR1A

Similar Products

Product Notes

The AVPR1A avpr1a (Catalog #AAA3240735) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The AVPR1A Peptide - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's AVPR1A can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the AVPR1A avpr1a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: PCCQNMKEKF NKEDTDSMSR RQTFYSNNRS PTNSTGMWKD SPKSSKSIKF. It is sometimes possible for the material contained within the vial of "AVPR1A, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.