ATP23 blocking peptide
ATP23 Peptide - C-terminal region
Gene Names
ATP23; KUB3; XRCC6BP1
Reactivity
Human
Applications
Western Blot
Synonyms
ATP23; ATP23 Peptide - C-terminal region; ATP23 blocking peptide
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
NISKEVAKKAVDEVFESCFNDHEPFGRIPHNKTYARYAHRDFENRDRYYS
Sequence Length
246
Applicable Applications for ATP23 blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for ATP23 blocking peptide
The protein encoded by this gene is amplified in glioblastomas and interacts with the DNA binding subunit of DNA-dependent protein kinase. This kinase is involved in double-strand break repair (DSB), and higher expression of the encoded protein increases the efficiency of DSB. In addition, comparison to orthologous proteins strongly suggests that this protein is a metalloprotease important in the biosynthesis of mitochondrial ATPase. Several transcript variants encoding different isoforms have been found for this gene.
Product Categories/Family for ATP23 blocking peptide
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
27kDa
NCBI Official Full Name
mitochondrial inner membrane protease ATP23 homolog isoform a
NCBI Official Synonym Full Names
ATP23 metallopeptidase and ATP synthase assembly factor homolog
NCBI Official Symbol
ATP23
NCBI Official Synonym Symbols
KUB3; XRCC6BP1
NCBI Protein Information
mitochondrial inner membrane protease ATP23 homolog
UniProt Protein Name
Mitochondrial inner membrane protease ATP23 homolog
Protein Family
UniProt Gene Name
XRCC6BP1
UniProt Synonym Gene Names
KUB3
UniProt Entry Name
ATP23_HUMAN
NCBI Description
The protein encoded by this gene is amplified in glioblastomas and interacts with the DNA binding subunit of DNA-dependent protein kinase. This kinase is involved in double-strand break repair (DSB), and higher expression of the encoded protein increases the efficiency of DSB. In addition, comparison to orthologous proteins strongly suggests that this protein is a metalloprotease important in the biosynthesis of mitochondrial ATPase. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Feb 2016]
Uniprot Description
Subunit structure: Interacts with XRCC6. Ref.1
Sequence similarities: Belongs to the peptidase M76 family.
Sequence caution: The sequence AAD31085.1 differs from that shown. Reason: Erroneous initiation.
Research Articles on ATP23
Similar Products
Product Notes
The ATP23 xrcc6bp1 (Catalog #AAA3242983) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The ATP23 Peptide - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ATP23 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ATP23 xrcc6bp1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: NISKEVAKKA VDEVFESCFN DHEPFGRIPH NKTYARYAHR DFENRDRYYS. It is sometimes possible for the material contained within the vial of "ATP23, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
