Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

ATG4C blocking peptide

ATG4C Peptide - middle region

Gene Names
ATG4C; APG4C; AUTL1; AUTL3; APG4-C
Reactivity
Human
Applications
Western Blot
Synonyms
ATG4C; ATG4C Peptide - middle region; ATG4C blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
TISLKETIGKYSDDHEMRNEVYHRKIISWFGDSPLALFGLHQLIEYGKKS
Sequence Length
458
Applicable Applications for ATG4C blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for ATG4C blocking peptide
This is a synthetic peptide designed for use in combination with anti-ATG4C Antibody, made

Target Description: Autophagy is the process by which endogenous proteins and damaged organelles are destroyed intracellularly. Autophagy is postulated to be essential for cell homeostasis and cell remodeling during differentiation, metamorphosis, non-apoptotic cell death, and aging. Reduced levels of autophagy have been described in some malignant tumors, and a role for autophagy in controlling the unregulated cell growth linked to cancer has been proposed. This gene encodes a member of the autophagin protein family. The encoded protein is also designated as a member of the C-54 family of cysteine proteases. Alternate transcriptional splice variants, encoding the same protein, have been characterized.
Product Categories/Family for ATG4C blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
52kDa
NCBI Official Full Name
cysteine protease ATG4C
NCBI Official Synonym Full Names
autophagy related 4C cysteine peptidase
NCBI Official Symbol
ATG4C
NCBI Official Synonym Symbols
APG4C; AUTL1; AUTL3; APG4-C
NCBI Protein Information
cysteine protease ATG4C
UniProt Protein Name
Cysteine protease ATG4C
Protein Family
UniProt Gene Name
ATG4C
UniProt Synonym Gene Names
APG4C; AUTL1; AUTL3
UniProt Entry Name
ATG4C_HUMAN

NCBI Description

Autophagy is the process by which endogenous proteins and damaged organelles are destroyed intracellularly. Autophagy is postulated to be essential for cell homeostasis and cell remodeling during differentiation, metamorphosis, non-apoptotic cell death, and aging. Reduced levels of autophagy have been described in some malignant tumors, and a role for autophagy in controlling the unregulated cell growth linked to cancer has been proposed. This gene encodes a member of the autophagin protein family. The encoded protein is also designated as a member of the C-54 family of cysteine proteases. Alternate transcriptional splice variants, encoding the same protein, have been characterized. [provided by RefSeq, Jul 2008]

Uniprot Description

ATG4C: Cysteine protease required for autophagy, which cleaves the C-terminal part of either MAP1LC3, GABARAPL2 or GABARAP, allowing the liberation of form I. A subpopulation of form I is subsequently converted to a smaller form (form II). Form II, with a revealed C-terminal glycine, is considered to be the phosphatidylethanolamine (PE)-conjugated form, and has the capacity for the binding to autophagosomes. Highly expressed in skeletal muscle, heart, liver and testis. Inhibited by N-ethylmaleimide. Belongs to the peptidase C54 family.

Protein type: EC 3.4.22.-; Protease; Autophagy; Ubiquitin conjugating system

Chromosomal Location of Human Ortholog: 1p31.3

Cellular Component: cytoplasm; extracellular region; cytosol

Molecular Function: peptidase activity; cysteine-type endopeptidase activity

Biological Process: protein delipidation; mitochondrion degradation; autophagy; protein processing; C-terminal protein lipidation; proteolysis; protein targeting to membrane; autophagic vacuole formation; cellular response to nitrogen starvation

Research Articles on ATG4C

Similar Products

Product Notes

The ATG4C atg4c (Catalog #AAA3239021) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The ATG4C Peptide - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ATG4C can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ATG4C atg4c for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: TISLKETIGK YSDDHEMRNE VYHRKIISWF GDSPLALFGL HQLIEYGKKS. It is sometimes possible for the material contained within the vial of "ATG4C, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.