Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

ATG3 blocking peptide

ATG3 Peptide - middle region

Gene Names
ATG3; APG3; APG3L; PC3-96; APG3-LIKE
Reactivity
Human
Applications
Western Blot
Synonyms
ATG3; ATG3 Peptide - middle region; ATG3 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
SDELEAIIEEDDGDGGWVDTYHNTGITGITEAVKEITLENKDNIRLQDCS
Sequence Length
314
Applicable Applications for ATG3 blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for ATG3 blocking peptide
This is a synthetic peptide designed for use in combination with anti-ATG3 Antibody, made

Target Description: Autophagy is a process of bulk degradation of cytoplasmic components by the lysosome or vacuole. Human ATG3 displays the same enzymatic characteristics in vitro as yeast Apg3, a protein-conjugating enzyme essential for autophagy (Tanida et al., 2002 [PubMed 11825910]).
Product Categories/Family for ATG3 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
36kDa
NCBI Official Full Name
ubiquitin-like-conjugating enzyme ATG3 isoform 1
NCBI Official Synonym Full Names
autophagy related 3
NCBI Official Symbol
ATG3
NCBI Official Synonym Symbols
APG3; APG3L; PC3-96; APG3-LIKE
NCBI Protein Information
ubiquitin-like-conjugating enzyme ATG3
UniProt Protein Name
Ubiquitin-like-conjugating enzyme ATG3
Protein Family
UniProt Gene Name
ATG3
UniProt Synonym Gene Names
APG3; APG3L; APG3-like; hApg3
UniProt Entry Name
ATG3_HUMAN

NCBI Description

This gene encodes a ubiquitin-like-conjugating enzyme and is a component of ubiquitination-like systems involved in autophagy, the process of degradation, turnover and recycling of cytoplasmic constituents in eukaryotic cells. This protein is known to play a role in regulation of autophagy during cell death. A pseudogene of this gene is located on chromosome 20. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jul 2013]

Uniprot Description

ATG3: an E2-like enzyme essential for Apg8p lipidation.

Protein type: Enzyme, cellular metabolism; EC 6.3.2.-; Autophagy; Ubiquitin conjugating system

Chromosomal Location of Human Ortholog: 3q13.2

Cellular Component: cytoplasmic ubiquitin ligase complex; cytosol

Molecular Function: protein binding; enzyme binding; small conjugating protein ligase activity; APG8 conjugating enzyme activity; APG12 conjugating enzyme activity

Biological Process: mitochondrion degradation; protein ubiquitination; protein modification process; mitochondrial fragmentation during apoptosis; protein targeting to membrane; autophagic vacuole formation

Research Articles on ATG3

Similar Products

Product Notes

The ATG3 atg3 (Catalog #AAA3239109) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The ATG3 Peptide - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ATG3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ATG3 atg3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: SDELEAIIEE DDGDGGWVDT YHNTGITGIT EAVKEITLEN KDNIRLQDCS. It is sometimes possible for the material contained within the vial of "ATG3, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.