Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

ASH2L blocking peptide

ASH2L Peptide - middle region

Gene Names
ASH2L; ASH2; Bre2; ASH2L1; ASH2L2
Reactivity
Human
Applications
Western Blot
Synonyms
ASH2L; ASH2L Peptide - middle region; ASH2L blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: MTWPNNIVKTMSKERDVFLVKEHPDPGSKDPEEDYPKFGLLDQDLSNIGP
Sequence Length
628
Applicable Applications for ASH2L blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for ASH2L blocking peptide
This is a synthetic peptide designed for use in combination with anti-ASH2L Antibody, made

Target Description: ASH2L is a component of the Set1/Ash2 histone methyltransferase (HMT) complex, a complex that specifically methylates 'Lys-4' of histone H3, but not if the neighboring 'Lys-9' residue is already methylated. As part of the MLL1/MLL complex it is involved in methylation and dimethylation at 'Lys-4' of histone H3. ASH2L may function as a transcriptional regulator and may play a role in hematopoiesis.
Product Categories/Family for ASH2L blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
69kDa
NCBI Official Full Name
set1/Ash2 histone methyltransferase complex subunit ASH2 isoform b
NCBI Official Synonym Full Names
ASH2 like, histone lysine methyltransferase complex subunit
NCBI Official Symbol
ASH2L
NCBI Official Synonym Symbols
ASH2; Bre2; ASH2L1; ASH2L2
NCBI Protein Information
set1/Ash2 histone methyltransferase complex subunit ASH2
UniProt Protein Name
Set1/Ash2 histone methyltransferase complex subunit ASH2
UniProt Gene Name
ASH2L
UniProt Synonym Gene Names
ASH2L1
UniProt Entry Name
ASH2L_HUMAN

Uniprot Description

ASH2L: Component of the Set1/Ash2 histone methyltransferase (HMT) complex, a complex that specifically methylates 'Lys-4' of histone H3, but not if the neighboring 'Lys-9' residue is already methylated. As part of the MLL1/MLL complex it is involved in methylation and dimethylation at 'Lys-4' of histone H3. May function as a transcriptional regulator. May play a role in hematopoiesis. Interacts with HCFC1. Core component of several methyltransferase-containing complexes including MLL1/MLL, ASCOM, MLL2/MLL3 and MLL3/MLL4. Each complex is at least composed of ASH2L, RBBP5, DPY30, WDR5, one or more specific histone methyltransferases (MLL, MLL2, MLL3 and MLL4), and the facultative components C16orf53/PA1, C17orf49, CHD8, E2F6, HCFC1, HCFC2, HSP70, INO80C, KDM6A, KANSL1, LAS1L, MAX, MCRS1, MEN1, MGA, KAT8/MOF, NCOA6, PAXIP1/PTIP, PELP1, PHF20, PRP31, RING2, RUVB1/TIP49A, RUVB2/TIP49B, SENP3, TAF1, TAF4, TAF6, TAF7, TAF9 and TEX10. Interacts with DPY30 and RBBP5; the interaction is direct. Component of the SET1 complex, at least composed of the catalytic subunit (SETD1A or SETD1B), WDR5, WDR82, RBBP5, ASH2L/ASH2, CXXC1/CFP1, HCFC1 and DPY30. Interacts with SETD1A and SETD1B. Ubiquitously expressed. Predominantly expressed in adult heart and testis and fetal lung and liver, with barely detectable expression in adult lung, liver, kidney, prostate, and peripheral leukocytes. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Methyltransferase; Transcription regulation

Chromosomal Location of Human Ortholog: 8p11.2

Cellular Component: nucleoplasm; histone methyltransferase complex; nucleus

Molecular Function: protein binding; DNA binding; histone lysine N-methyltransferase activity (H3-K4 specific); metal ion binding

Biological Process: transcription from RNA polymerase II promoter; establishment and/or maintenance of chromatin architecture; regulation of transcription, DNA-dependent; transcription, DNA-dependent; response to estrogen stimulus; positive regulation of cell proliferation; histone H3-K4 methylation; positive regulation of transcription from RNA polymerase II promoter; hemopoiesis; response to DNA damage stimulus

Research Articles on ASH2L

Similar Products

Product Notes

The ASH2L ash2l (Catalog #AAA3244528) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The ASH2L Peptide - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ASH2L can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ASH2L ash2l for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MTWPNNIVKT MSKERDVFLV KEHPDPGSKD PEEDYPKFGL LDQDLSNIGP. It is sometimes possible for the material contained within the vial of "ASH2L, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.