Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

APOC2 blocking peptide

APOC2 Peptide - middle region

Gene Names
APOC2; APO-CII; APOC-II
Reactivity
Human
Synonyms
APOC2; APOC2 Peptide - middle region; APOC2 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: ESAKTAAQNLYEKTYLPAVDEKLRDLYSKSTAAMSTYTGIFTDQVLSVLK
Sequence Length
101
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for APOC2 blocking peptide
This is a synthetic peptide designed for use in combination with anti-APOC2 Antibody, made

Target Description: This gene encodes a lipid-binding protein belonging to the apolipoprotein gene family. The protein is secreted in plasma where it is a component of very low density lipoprotein. This protein activates the enzyme lipoprotein lipase, which hydrolyzes triglycerides and thus provides free fatty acids for cells. Mutations in this gene cause hyperlipoproteinemia type IB, characterized by hypertriglyceridemia, xanthomas, and increased risk of pancreatitis and early atherosclerosis. This gene is present in a cluster with other related apolipoprotein genes on chromosome 19. Naturally occurring read-through transcription exists between this gene and the neighboring upstream apolipoprotein C-IV (APOC4) gene.
Product Categories/Family for APOC2 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
344
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
11kDa
NCBI Official Full Name
apolipoprotein C-II
NCBI Official Synonym Full Names
apolipoprotein C2
NCBI Official Symbol
APOC2
NCBI Official Synonym Symbols
APO-CII; APOC-II
NCBI Protein Information
apolipoprotein C-II
UniProt Protein Name
Apolipoprotein C-II
Protein Family
UniProt Gene Name
APOC2
UniProt Synonym Gene Names
APC2; Apo-CII; ApoC-II
UniProt Entry Name
APOC2_HUMAN

NCBI Description

This gene encodes a lipid-binding protein belonging to the apolipoprotein gene family. The protein is secreted in plasma where it is a component of very low density lipoprotein. This protein activates the enzyme lipoprotein lipase, which hydrolyzes triglycerides and thus provides free fatty acids for cells. Mutations in this gene cause hyperlipoproteinemia type IB, characterized by hypertriglyceridemia, xanthomas, and increased risk of pancreatitis and early atherosclerosis. This gene is present in a cluster with other related apolipoprotein genes on chromosome 19. Naturally occurring read-through transcription exists between this gene and the neighboring upstream apolipoprotein C-IV (APOC4) gene. [provided by RefSeq, Mar 2011]

Uniprot Description

APOC2: Component of the very low density lipoprotein (VLDL) fraction in plasma, and is an activator of several triacylglycerol lipases. The association of APOC2 with plasma chylomicrons, VLDL, and HDL is reversible, a function of the secretion and catabolism of triglyceride-rich lipoproteins, and changes rapidly. Defects in APOC2 are the cause of hyperlipoproteinemia type 1B (HLPP1B). It is an autosomal recessive trait characterized by hypertriglyceridemia, xanthomas, and increased risk of pancreatitis and early atherosclerosis. Belongs to the apolipoprotein C2 family.

Protein type: Secreted; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 19q13.2

Cellular Component: extracellular space; chylomicron; early endosome; extracellular region

Molecular Function: protein homodimerization activity; phospholipase binding; lipase inhibitor activity; lipid binding; phospholipase activator activity

Biological Process: positive regulation of fatty acid biosynthetic process; phototransduction, visible light; cholesterol homeostasis; reverse cholesterol transport; phospholipid efflux; negative regulation of cholesterol transport; negative regulation of catalytic activity; positive regulation of lipoprotein lipase activity; negative regulation of receptor-mediated endocytosis; lipoprotein metabolic process; cholesterol efflux; negative regulation of lipid metabolic process; retinoid metabolic process; lipid catabolic process

Disease: Apolipoprotein C-ii Deficiency

Research Articles on APOC2

Similar Products

Product Notes

The APOC2 apoc2 (Catalog #AAA3236548) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The APOC2 Peptide - middle region reacts with Human and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: Synthetic peptide located within the following region: ESAKTAAQNL YEKTYLPAVD EKLRDLYSKS TAAMSTYTGI FTDQVLSVLK. It is sometimes possible for the material contained within the vial of "APOC2, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.