Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

APOA2 blocking peptide

APOA2 Peptide - N-terminal region

Gene Names
APOA2; apoAII; Apo-AII; ApoA-II
Reactivity
Human
Applications
Western Blot
Synonyms
APOA2; APOA2 Peptide - N-terminal region; APOA2 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
MKLLAATVLLLTICSLEGALVRRQAKEPCVESLVSQYFQTVTDYGKDLME
Sequence Length
100
Applicable Applications for APOA2 blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for APOA2 blocking peptide
This is a synthetic peptide designed for use in combination with anti-APOA2 Antibody, made

Target Description: This gene encodes apolipoprotein (apo-) A-II, which is the second most abundant protein of the high density lipoprotein particles. The protein is found in plasma as a monomer, homodimer, or heterodimer with apolipoprotein D. Defects in this gene may result in apolipoprotein A-II deficiency or hypercholesterolemia.
Product Categories/Family for APOA2 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
336
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
9kDa
NCBI Official Full Name
apolipoprotein A-II preproprotein
NCBI Official Synonym Full Names
apolipoprotein A2
NCBI Official Symbol
APOA2
NCBI Official Synonym Symbols
apoAII; Apo-AII; ApoA-II
NCBI Protein Information
apolipoprotein A-II
UniProt Protein Name
Apolipoprotein A-II
Protein Family
UniProt Gene Name
APOA2
UniProt Synonym Gene Names
Apo-AII; ApoA-II
UniProt Entry Name
APOA2_HUMAN

NCBI Description

This gene encodes apolipoprotein (apo-) A-II, which is the second most abundant protein of the high density lipoprotein particles. The protein is found in plasma as a monomer, homodimer, or heterodimer with apolipoprotein D. Defects in this gene may result in apolipoprotein A-II deficiency or hypercholesterolemia. [provided by RefSeq, Jul 2008]

Uniprot Description

APOA2: May stabilize HDL (high density lipoprotein) structure by its association with lipids, and affect the HDL metabolism. Belongs to the apolipoprotein A2 family.

Protein type: Endoplasmic reticulum; Secreted, signal peptide; Secreted; Lipid-binding

Chromosomal Location of Human Ortholog: 1q23.3

Cellular Component: chylomicron; endoplasmic reticulum lumen; early endosome; extracellular region; cytosol

Molecular Function: lipid transporter activity; protein binding; protein homodimerization activity; lipase inhibitor activity; protein heterodimerization activity; cholesterol transporter activity; cholesterol binding; phospholipid binding; phosphatidylcholine binding; lipid binding; high-density lipoprotein binding; apolipoprotein receptor binding

Biological Process: positive regulation of catalytic activity; phototransduction, visible light; viral reproduction; protein folding; negative regulation of cholesterol transport; response to glucocorticoid stimulus; regulation of protein stability; diacylglycerol catabolic process; positive regulation of lipid catabolic process; cellular lipid metabolic process; negative regulation of lipase activity; negative regulation of lipid catabolic process; regulation of cholesterol absorption; phospholipid efflux; response to glucose stimulus; retinoid metabolic process; response to drug; cholesterol metabolic process; organ regeneration; protein amino acid oxidation; phospholipid catabolic process; positive regulation of interleukin-8 biosynthetic process; cholesterol efflux; lipoprotein metabolic process; negative regulation of cytokine secretion during immune response; cholesterol homeostasis; triacylglycerol metabolic process; reverse cholesterol transport; response to estrogen stimulus; peptidyl-methionine modification; phosphatidylcholine biosynthetic process; acute inflammatory response

Disease: Hypercholesterolemia, Familial

Research Articles on APOA2

Similar Products

Product Notes

The APOA2 apoa2 (Catalog #AAA3236700) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The APOA2 Peptide - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's APOA2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the APOA2 apoa2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MKLLAATVLL LTICSLEGAL VRRQAKEPCV ESLVSQYFQT VTDYGKDLME. It is sometimes possible for the material contained within the vial of "APOA2, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.