Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged DEFA1 is ~0.1ng/ml as a capture antibody.)

Mouse anti-Human DEFA1 Monoclonal Antibody | anti-DEFA1 antibody

DEFA1 (Neutrophil Defensin 1, Defensin, alpha 1, HNP-1, HP-1, HP1, DEF1, DEFA2, MRS, DEFA1B) (HRP)

Gene Names
DEFA3; HP3; DEF3; HNP3; HP-3; HNP-3
Reactivity
Human
Applications
ELISA
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
DEFA1; Monoclonal Antibody; DEFA1 (Neutrophil Defensin 1; Defensin; alpha 1; HNP-1; HP-1; HP1; DEF1; DEFA2; MRS; DEFA1B) (HRP); anti-DEFA1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3G9
Specificity
Recognizes human DEFA1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Applicable Applications for anti-DEFA1 antibody
ELISA (EIA)
Application Notes
Sandwich ELISA: The detection limit is ~0.1ng/ml as a capture antibody.
Applications are based on unconjugated antibody.
Immunogen
Full length recombinant corresponding to aa1-94 from human DEFA1 (AAH27917) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MRTLAILAAILLVALQAQAEPLQARADEVAAAPEQIAADIPEVVVSLAWDESLAPKHPGSRKNMDCYCRIPACIAGERRYGTCIYQGRLWAFCC
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged DEFA1 is ~0.1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged DEFA1 is ~0.1ng/ml as a capture antibody.)
Product Categories/Family for anti-DEFA1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
10,245 Da
NCBI Official Full Name
Homo sapiens defensin, alpha 3, neutrophil-specific, mRNA
NCBI Official Synonym Full Names
defensin alpha 3
NCBI Official Symbol
DEFA3
NCBI Official Synonym Symbols
HP3; DEF3; HNP3; HP-3; HNP-3
NCBI Protein Information
neutrophil defensin 3
Protein Family

NCBI Description

Defensins are a family of antimicrobial and cytotoxic peptides thought to be involved in host defense. They are abundant in the granules of neutrophils and also found in the epithelia of mucosal surfaces such as those of the intestine, respiratory tract, urinary tract, and vagina. Members of the defensin family are highly similar in protein sequence and distinguished by a conserved cysteine motif. The protein encoded by this gene, defensin, alpha 3, is found in the microbicidal granules of neutrophils and likely plays a role in phagocyte-mediated host defense. Several alpha defensin genes are clustered on chromosome 8. This gene differs from defensin, alpha 1 by only one amino acid. This gene and the gene encoding defensin, alpha 1 are both subject to copy number variation. [provided by RefSeq, Oct 2014]

Research Articles on DEFA1

Similar Products

Product Notes

The DEFA1 (Catalog #AAA6152119) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The DEFA1 (Neutrophil Defensin 1, Defensin, alpha 1, HNP-1, HP-1, HP1, DEF1, DEFA2, MRS, DEFA1B) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's DEFA1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA). Sandwich ELISA: The detection limit is ~0.1ng/ml as a capture antibody. Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the DEFA1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "DEFA1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.