AIDA blocking peptide
AIDA Peptide - N-terminal region
Gene Names
AIDA; C1orf80
Reactivity
Human
Applications
Western Blot
Synonyms
AIDA; AIDA Peptide - N-terminal region; AIDA blocking peptide
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
WGASFRRGADFDSWGQLVEAIDEYQILARHLQKEAQAQHNNSEFTEEQKK
Sequence Length
306
Applicable Applications for AIDA blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for AIDA blocking peptide
This is a synthetic peptide designed for use in combination with anti-AIDA Antibody, made
Target Description: AIDA acts as a ventralizing factor during embryogenesis. AIDA inhibits axin-mediated JNK activation by binding axin and disrupting axin homodimerization. This in turn antagonizes a Wnt/beta-catenin-independent dorsalization pathway activated by AXIN/JNK-signaling.
Target Description: AIDA acts as a ventralizing factor during embryogenesis. AIDA inhibits axin-mediated JNK activation by binding axin and disrupting axin homodimerization. This in turn antagonizes a Wnt/beta-catenin-independent dorsalization pathway activated by AXIN/JNK-signaling.
Product Categories/Family for AIDA blocking peptide
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
34kDa
NCBI Official Full Name
axin interactor, dorsalization-associated protein
NCBI Official Synonym Full Names
axin interactor, dorsalization associated
NCBI Official Symbol
AIDA
NCBI Official Synonym Symbols
C1orf80
NCBI Protein Information
axin interactor, dorsalization-associated protein
UniProt Protein Name
Axin interactor, dorsalization-associated protein
Protein Family
UniProt Gene Name
AIDA
UniProt Synonym Gene Names
C1orf80
UniProt Entry Name
AIDA_HUMAN
Uniprot Description
AIDA: Acts as a ventralizing factor during embryogenesis. Inhibits axin-mediated JNK activation by binding axin and disrupting axin homodimerization. This in turn antagonizes a Wnt/beta-catenin-independent dorsalization pathway activated by AXIN/JNK-signaling. Belongs to the AIDA family. 3 isoforms of the human protein are produced by alternative splicing.
Protein type: Cell development/differentiation
Chromosomal Location of Human Ortholog: 1q41
Cellular Component: cytoplasm
Molecular Function: protein domain specific binding
Biological Process: negative regulation of JNK cascade; negative regulation of JNK activity; dorsal/ventral pattern formation; regulation of protein homodimerization activity
Similar Products
Product Notes
The AIDA aida (Catalog #AAA3240768) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The AIDA Peptide - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's AIDA can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the AIDA aida for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: WGASFRRGAD FDSWGQLVEA IDEYQILARH LQKEAQAQHN NSEFTEEQKK. It is sometimes possible for the material contained within the vial of "AIDA, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
