Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of AIDA expression in human placenta using MBS6004223)

Mouse anti-Human AIDA Polyclonal Antibody

AIDA (Axin Interactor, Dorsalization-associated Protein, Axin Interaction Partner and Dorsalization Antagonist, C1orf80, FLJ12806, FLJ32421, RP11-378J18.7)

Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
AIDA; Polyclonal Antibody; AIDA (Axin Interactor; Dorsalization-associated Protein; Axin Interaction Partner and Dorsalization Antagonist; C1orf80; FLJ12806; FLJ32421; RP11-378J18.7); Anti -AIDA (Axin Interactor; anti-AIDA antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human C1orf80.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MSEVTRSLLQRWGASFRRGADFDSWGQLVEAIDEYQILARHLQKEAQAQHNNSEFTEEQKKTIGKIATCLELRSAALQSTQSQEEFKLEDLKKLEPILKNILTYNKEFPFDVQPVPLRRILAPGEEENLEFEEDEEEGGAGAGSPDSFPARVPGTLLPRLPSEPGMTLLTIRIEKIGLKDAGQCIDPYITVSVKDLNGIDLTPVQDTPVASRKEDTYVHFNVDIELQKHVEKLTKGAAIFFEFKHYKPKKRFTSTKCFAFMEMDEIKPGPIVIELYKKPTDFKRKKLQLLTKKPLYLHLHQTLHKE
Applicable Applications for anti-AIDA antibody
Western Blot (WB)
Application Notes
Suitable for use in Western Blot.
Immunogen
Full length human C1orf80, aa1-306 (NP_073742.2).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of AIDA expression in human placenta using MBS6004223)

Western Blot (WB) (Western Blot analysis of AIDA expression in human placenta using MBS6004223)

Western Blot (WB)

(Western Blot analysis of AIDA expression in transfected 293T cell line by MBS6004223. Lane 1: AIDA transfected lysate (33.66kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of AIDA expression in transfected 293T cell line by MBS6004223. Lane 1: AIDA transfected lysate (33.66kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-AIDA antibody
AIDA acts as a ventralizing factor during embryogenesis. Inhibits axin-mediated JNK activation by binding axin and disrupting axin homodimerization. This in turn antagonizes a Wnt/beta-catenin-independent dorsalization pathway activated by AXIN/JNK-signaling (By similarity).
Product Categories/Family for anti-AIDA antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI Official Full Name
AidA
Protein Family

Similar Products

Product Notes

The AIDA (Catalog #AAA6004223) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The AIDA (Axin Interactor, Dorsalization-associated Protein, Axin Interaction Partner and Dorsalization Antagonist, C1orf80, FLJ12806, FLJ32421, RP11-378J18.7) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's AIDA can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Suitable for use in Western Blot. Researchers should empirically determine the suitability of the AIDA for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MSEVTRSLLQ RWGASFRRGA DFDSWGQLVE AIDEYQILAR HLQKEAQAQH NNSEFTEEQK KTIGKIATCL ELRSAALQST QSQEEFKLED LKKLEPILKN ILTYNKEFPF DVQPVPLRRI LAPGEEENLE FEEDEEEGGA GAGSPDSFPA RVPGTLLPRL PSEPGMTLLT IRIEKIGLKD AGQCIDPYIT VSVKDLNGID LTPVQDTPVA SRKEDTYVHF NVDIELQKHV EKLTKGAAIF FEFKHYKPKK RFTSTKCFAF MEMDEIKPGP IVIELYKKPT DFKRKKLQLL TKKPLYLHLH QTLHKE. It is sometimes possible for the material contained within the vial of "AIDA, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.