Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

AGK blocking peptide

AGK Peptide - middle region

Gene Names
AGK; MULK; CATC5; CTRCT38; MTDPS10
Reactivity
Human
Synonyms
AGK; AGK Peptide - middle region; AGK blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: WPQTHQASISYTGPTERPPNEPEETPVQRPSLYRRILRRLASYWAQPQDA
Sequence Length
422
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for AGK blocking peptide
This is a synthetic peptide designed for use in combination with anti- AGK Antibody, made

Target Description: The protein encoded by this gene is a mitochondrial membrane protein involved in lipid and glycerolipid metabolism. The encoded protein is a lipid kinase that catalyzes the formation of phosphatidic and lysophosphatidic acids. Defects in this gene have been associated with mitochondrial DNA depletion syndrome 10.
Product Categories/Family for AGK blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
46 kDa
NCBI Official Full Name
acylglycerol kinase, mitochondrial isoform 1
NCBI Official Synonym Full Names
acylglycerol kinase
NCBI Official Symbol
AGK
NCBI Official Synonym Symbols
MULK; CATC5; CTRCT38; MTDPS10
NCBI Protein Information
acylglycerol kinase, mitochondrial
UniProt Protein Name
Acylglycerol kinase, mitochondrial
Protein Family
UniProt Gene Name
AGK
UniProt Synonym Gene Names
MULK; hAGK; HsMuLK; MuLK
UniProt Entry Name
AGK_HUMAN

NCBI Description

The protein encoded by this gene is a mitochondrial membrane protein involved in lipid and glycerolipid metabolism. The encoded protein is a lipid kinase that catalyzes the formation of phosphatidic and lysophosphatidic acids. Defects in this gene have been associated with mitochondrial DNA depletion syndrome 10. [provided by RefSeq, Feb 2012]

Uniprot Description

AGK: Lipid kinase that can phosphorylate both monoacylglycerol and diacylglycerol to form lysophosphatidic acid (LPA) and phosphatidic acid (PA), respectively. Does not phosphorylate sphingosine. Overexpression increases the formation and secretion of LPA, resulting in transactivation of EGFR and activation of the downstream MAPK signaling pathway, leading to increased cell growth. Defects in AGK are the cause of mitochondrial DNA depletion syndrome type 10 (MTDPS10). An autosomal recessive mitochondrial disorder characterized by congenital cataracts, hypertrophic cardiomyopathy, skeletal myopathy, exercise intolerance, and lactic acidosis. Mental development is normal, but affected individuals may die early from cardiomyopathy. Defects in AGK are the cause of cataract, congenital, autosomal recessive type 5 (CATC5). CATC5 consists of an opacification of the crystalline lens of the eye becoming evident at birth. It frequently results in visual impairment or blindness. Opacities vary in morphology, are often confined to a portion of the lens, and may be static or progressive. In general, the more posteriorly located and dense an opacity, the greater the impact on visual function. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Lipid Metabolism - glycerolipid; Motility/polarity/chemotaxis; Kinase, lipid; EC 2.7.1.107; EC 2.7.1.94

Chromosomal Location of Human Ortholog: 7q34

Cellular Component: mitochondrion; intracellular membrane-bound organelle; mitochondrial membrane

Molecular Function: acylglycerol kinase activity; ceramide kinase activity; diacylglycerol kinase activity; ATP binding; NAD+ kinase activity

Biological Process: protein kinase C activation; ceramide biosynthetic process; glycerolipid metabolic process; lipid phosphorylation

Disease: Cataract 38; Sengers Syndrome

Research Articles on AGK

Similar Products

Product Notes

The AGK agk (Catalog #AAA3247185) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The AGK Peptide - middle region reacts with Human and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: Synthetic peptide located within the following region: WPQTHQASIS YTGPTERPPN EPEETPVQRP SLYRRILRRL ASYWAQPQDA. It is sometimes possible for the material contained within the vial of "AGK, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.