Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

ACE2 blocking peptide

ACE2 Peptide - C-terminal region

Gene Names
ACE2; ACEH
Reactivity
Human
Synonyms
ACE2; ACE2 Peptide - C-terminal region; ACE2 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: PNQPPVSIWLIVFGVVMGVIVVGIVILIFTGIRDRKKKNKARSGENPYAS
Sequence Length
805
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for ACE2 blocking peptide
This is a synthetic peptide designed for use in combination with anti- ACE2 Antibody, made

Target Description: The protein encoded by this gene belongs to the angiotensin-converting enzyme family of dipeptidyl carboxydipeptidases and has considerable homology to human angiotensin 1 converting enzyme. This secreted protein catalyzes the cleavage of angiotensin I into angiotensin 1-9, and angiotensin II into the vasodilator angiotensin 1-7. The organ- and cell-specific expression of this gene suggests that it may play a role in the regulation of cardiovascular and renal function, as well as fertility. In addition, the encoded protein is a functional receptor for the spike glycoprotein of the human coronaviruses SARS and HCoV-NL63.
Product Categories/Family for ACE2 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
88 kDa
NCBI Official Full Name
angiotensin-converting enzyme 2
NCBI Official Synonym Full Names
angiotensin I converting enzyme 2
NCBI Official Symbol
ACE2
NCBI Official Synonym Symbols
ACEH
NCBI Protein Information
angiotensin-converting enzyme 2
UniProt Protein Name
Angiotensin-converting enzyme 2
UniProt Gene Name
ACE2
UniProt Synonym Gene Names
ACEH
UniProt Entry Name
ACE2_HUMAN

NCBI Description

The protein encoded by this gene belongs to the angiotensin-converting enzyme family of dipeptidyl carboxydipeptidases and has considerable homology to human angiotensin 1 converting enzyme. This secreted protein catalyzes the cleavage of angiotensin I into angiotensin 1-9, and angiotensin II into the vasodilator angiotensin 1-7. The organ- and cell-specific expression of this gene suggests that it may play a role in the regulation of cardiovascular and renal function, as well as fertility. In addition, the encoded protein is a functional receptor for the spike glycoprotein of the human coronaviruses SARS and HCoV-NL63. [provided by RefSeq, Jul 2008]

Uniprot Description

ACE2: Carboxypeptidase which converts angiotensin I to angiotensin 1-9, a peptide of unknown function, and angiotensin II to angiotensin 1-7, a vasodilator. Also able to hydrolyze apelin- 13 and dynorphin-13 with high efficiency. May be an important regulator of heart function. In case of human coronaviruses SARS and HCoV-NL63 infections, serve as functional receptor for the spike glycoprotein of both coronaviruses. Interacts with ITGB1. Interacts with SARS-CoV and HCoV- NL63 spike glycoprotein. Up-regulated in failing heart. Expressed in endothelial cells from small and large arteries, and in arterial smooth muscle cells. Expressed in lung alveolar epithelial cells, enterocytes of the small intestine, Leydig cells and Sertoli cells. Expressed in heart, kidney, testis, and gastrointestinal system. Activated by chloride and fluoride, but not bromide. Inhibited by MLN-4760, cFP_Leu, and EDTA, but not by the ACE inhibitors linosipril, captopril and enalaprilat. Belongs to the peptidase M2 family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: EC 3.4.17.23; Membrane protein, integral; Protease

Chromosomal Location of Human Ortholog: Xp22

Cellular Component: extracellular space; cell surface; cytoplasm; integral to membrane; plasma membrane; extracellular region; lipid raft

Molecular Function: peptidyl-dipeptidase activity; viral receptor activity; protein binding; metallopeptidase activity; carboxypeptidase activity; zinc ion binding; peptide hormone binding; endopeptidase activity; glycoprotein binding

Biological Process: virion attachment, binding of host cell surface receptor; entry of virus into host cell; maternal process involved in pregnancy; regulation of vasodilation; proteolysis; angiotensin maturation; regulation of systemic arterial blood pressure by renin-angiotensin; regulation of cell proliferation; regulation of cytokine production; cellular protein metabolic process; regulation of vasoconstriction; regulation of inflammatory response; angiotensin catabolic process in blood; receptor biosynthetic process; angiotensin mediated drinking behavior

Research Articles on ACE2

Similar Products

Product Notes

The ACE2 ace2 (Catalog #AAA3247732) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The ACE2 Peptide - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: Synthetic peptide located within the following region: PNQPPVSIWL IVFGVVMGVI VVGIVILIFT GIRDRKKKNK ARSGENPYAS. It is sometimes possible for the material contained within the vial of "ACE2, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.