ACAD10 blocking peptide

ACAD10 Peptide - C-terminal region

Cat. Num. AAA3239880

• Reactivity: Human
• Applications: Western Blot
• Synonyms: ACAD10; ACAD10 Peptide - C-terminal region; ACAD10 blocking peptide

• Reactivity: Human
• Form/Format: Lyophilized powder
• Sequence: Synthetic peptide located within the following region: LKEKAKAEGLWNLFLPLEADPEKKYGAGLTNVEYAHLCELMGTSLYAPEV
• Sequence Length: 492

• Applicable Applications for ACAD10 blocking peptide: Western Blot (WB)
• Preparation and Storage: Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.

Related Product Information for ACAD10 blocking peptide

This is a synthetic peptide designed for use in combination with anti-ACAD10 Antibody, made

Target Description: This gene encodes a member of the acyl-CoA dehydrogenase family of enzymes (ACADs), which participate in the beta-oxidation of fatty acids in mitochondria. The encoded enzyme contains a hydrolase domain at the N-terminal portion, a serine/threonine protein kinase catlytic domain in the central region, and a conserved ACAD domain at the C-terminus. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some of these variants has not been determined.

Product Categories/Family for ACAD10 blocking peptide

Peptide

NCBI and Uniprot Product Information

• NCBI GI #: 211971008
• NCBI GeneID: 80724
• NCBI Accession #: NP_001130010.1
• NCBI GenBank Nucleotide #: NM_001136538.1
• UniProt Accession #: Q6JQN1
• Molecular Weight: 54kDa
• NCBI Official Full Name: acyl-CoA dehydrogenase family member 10 isoform a
• NCBI Official Synonym Full Names: acyl-CoA dehydrogenase family member 10
• NCBI Official Symbol: ACAD10
• NCBI Protein Information: acyl-CoA dehydrogenase family member 10
• UniProt Protein Name: Acyl-CoA dehydrogenase family member 10
• Protein Family: Acyl-CoA dehydrogenase family
• UniProt Gene Name: ACAD10
• UniProt Synonym Gene Names: ACAD-10
• UniProt Entry Name: ACD10_HUMAN

NCBI Description

This gene encodes a member of the acyl-CoA dehydrogenase family of enzymes (ACADs), which participate in the beta-oxidation of fatty acids in mitochondria. The encoded enzyme contains a hydrolase domain at the N-terminal portion, a serine/threonine protein kinase catlytic domain in the central region, and a conserved ACAD domain at the C-terminus. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some of these variants has not been determined. [provided by RefSeq, Nov 2008]

Uniprot Description

ACAD10: Acyl-CoA dehydrogenase only active with R- and S-2- methyl-C15-CoA. Belongs to the acyl-CoA dehydrogenase family. 4 isoforms of the human protein are produced by alternative splicing.

Protein type: Mitochondrial; Oxidoreductase; EC 1.3.99.-

Chromosomal Location of Human Ortholog: 12q24.12

Cellular Component: mitochondrion

Molecular Function: acyl-CoA dehydrogenase activity; FAD binding; hydrolase activity; transferase activity, transferring phosphorus-containing groups