Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

ABHD11 blocking peptide

ABHD11 Peptide - middle region

Gene Names
ABHD11; PP1226; WBSCR21
Reactivity
Human
Applications
Western Blot
Synonyms
ABHD11; ABHD11 Peptide - middle region; ABHD11 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: QQTGRRVLTVDARNHGDSPHSPDMSYEIMSQDLQDLLPQLGLVPCVVVGH
Sequence Length
315
Applicable Applications for ABHD11 blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for ABHD11 blocking peptide
This is a synthetic peptide designed for use in combination with anti-ABHD11 Antibody, made

Target Description: This gene encodes a protein containing an alpha/beta hydrolase fold domain. This gene is deleted in Williams syndrome, a multisystem developmental disorder caused by the deletion of contiguous genes at 7q11.23. Alternatively spliced transcript variants have been described, but their biological validity has not been determined.
Product Categories/Family for ABHD11 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
35 kDa
NCBI Official Full Name
protein ABHD11 isoform 8
NCBI Official Synonym Full Names
abhydrolase domain containing 11
NCBI Official Symbol
ABHD11
NCBI Official Synonym Symbols
PP1226; WBSCR21
NCBI Protein Information
protein ABHD11
UniProt Protein Name
Alpha/beta hydrolase domain-containing protein 11
Protein Family
UniProt Gene Name
ABHD11
UniProt Synonym Gene Names
WBSCR21; Abhydrolase domain-containing protein 11
UniProt Entry Name
ABHDB_HUMAN

NCBI Description

This gene encodes a protein containing an alpha/beta hydrolase fold domain. This gene is deleted in Williams syndrome, a multisystem developmental disorder caused by the deletion of contiguous genes at 7q11.23. [provided by RefSeq, Mar 2016]

Uniprot Description

ABHD11: ABHD11 is located in the Williams-Beuren syndrome (WBS) critical region. WBS results from a hemizygous deletion of several genes on chromosome 7q11.23, thought to arise as a consequence of unequal crossing over between highly homologous low-copy repeat sequences flanking the deleted region. Belongs to the AB hydrolase superfamily. 5 isoforms of the human protein are produced by alternative splicing.

Protein type: EC 3.-.-.-; Hydrolase

Chromosomal Location of Human Ortholog: 7q11.23

Cellular Component: mitochondrion

Molecular Function: hydrolase activity

Biological Process: metabolic process

Research Articles on ABHD11

Similar Products

Product Notes

The ABHD11 abhd11 (Catalog #AAA3245783) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The ABHD11 Peptide - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ABHD11 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ABHD11 abhd11 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: QQTGRRVLTV DARNHGDSPH SPDMSYEIMS QDLQDLLPQL GLVPCVVVGH. It is sometimes possible for the material contained within the vial of "ABHD11, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.