Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

ABCB7 blocking peptide

ABCB7 Peptide - C-terminal region

Gene Names
ABCB7; ABC7; ASAT; Atm1p; EST140535
Reactivity
Human
Applications
Western Blot
Synonyms
ABCB7; ABCB7 Peptide - C-terminal region; ABCB7 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: ADEIIVLDQGKVAERGTHHGLLANPHSIYSEMWHTQSSRVQNHDNPKWEA
Sequence Length
752
Applicable Applications for ABCB7 blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for ABCB7 blocking peptide
This is a synthetic peptide designed for use in combination with anti-ABCB7 Antibody, made

Target Description: The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the MDR/TAP subfamily. Members of the MDR/TAP subfamily are involved in multidrug resistance as well as antigen presentation. This gene encodes a half-transporter involved in the transport of heme from the mitochondria to the cytosol. With iron/sulfur cluster precursors as its substrates, this protein may play a role in metal homeostasis. Mutations in this gene have been associated with mitochondrial iron accumulation and isodicentric (X)(q13) and sideroblastic anemia. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.
Product Categories/Family for ABCB7 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
22
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
82kDa
NCBI Official Full Name
ATP-binding cassette sub-family B member 7, mitochondrial isoform 2
NCBI Official Synonym Full Names
ATP binding cassette subfamily B member 7
NCBI Official Symbol
ABCB7
NCBI Official Synonym Symbols
ABC7; ASAT; Atm1p; EST140535
NCBI Protein Information
ATP-binding cassette sub-family B member 7, mitochondrial
UniProt Protein Name
ATP-binding cassette sub-family B member 7, mitochondrial
Protein Family
UniProt Gene Name
ABCB7
UniProt Synonym Gene Names
ABC7; ABC transporter 7 protein
UniProt Entry Name
ABCB7_HUMAN

NCBI Description

The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the MDR/TAP subfamily. Members of the MDR/TAP subfamily are involved in multidrug resistance as well as antigen presentation. This gene encodes a half-transporter involved in the transport of heme from the mitochondria to the cytosol. With iron/sulfur cluster precursors as its substrates, this protein may play a role in metal homeostasis. Mutations in this gene have been associated with mitochondrial iron accumulation and isodicentric (X)(q13) and sideroblastic anemia. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Nov 2012]

Uniprot Description

ABCB7: Could be involved in the transport of heme from the mitochondria to the cytosol. Plays a central role in the maturation of cytosolic iron-sulfur (Fe/S) cluster-containing proteins. Defects in ABCB7 are the cause of X-linked sideroblastic anemia with ataxia (ASAT). ASAT is a recessive disorder characterized by an infantile to early childhood onset of nonprogressive cerebellar ataxia and mild anemia with hypochromia and microcytosis. Belongs to the ABC transporter superfamily. ABCB family. Heavy Metal importer (TC 3.A.1.210) subfamily. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Transporter; Transporter, ABC family; Membrane protein, multi-pass; Membrane protein, integral; Mitochondrial

Chromosomal Location of Human Ortholog: Xq13.3

Cellular Component: mitochondrion; mitochondrial inner membrane; integral to membrane

Molecular Function: ATPase activity, coupled to transmembrane movement of substances; heme transporter activity; ATP binding

Biological Process: heme transport; transport; cellular iron ion homeostasis; transmembrane transport

Disease: Anemia, Sideroblastic, And Spinocerebellar Ataxia

Research Articles on ABCB7

Similar Products

Product Notes

The ABCB7 abcb7 (Catalog #AAA3244281) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The ABCB7 Peptide - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ABCB7 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ABCB7 abcb7 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ADEIIVLDQG KVAERGTHHG LLANPHSIYS EMWHTQSSRV QNHDNPKWEA. It is sometimes possible for the material contained within the vial of "ABCB7, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.