Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

5-hydroxytryptamine receptor 7 (Htr7) Recombinant Protein | Htr7 recombinant protein

Recombinant Rat 5-hydroxytryptamine receptor 7 (Htr7)

Gene Names
Htr7; 5Ht7
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
5-hydroxytryptamine receptor 7 (Htr7); Recombinant Rat 5-hydroxytryptamine receptor 7 (Htr7); Htr7 recombinant protein
Ordering
For Research Use Only!
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-448aa; Full length protein
Sequence
MMDVNSSGRPDLYGHLRSLILPEVGRGLQDLSPDGGAHPVVSSWMPHLLSGFLEVTASPA PTWDAPPDNVSGCGEQINYGRVEKVVIGSILTLITLLTIAGNCLVVISVCFVKKLRQPSN YLIVSLALADLSVAVAVMPFVSVTDLIGGKWIFGHFFCNVFIAMDVMCCTASIMTLCVIS IDRYLGITRPLTYPVRQNGKCMAKMILSVWLLSASITLPPLFGWAQNVNDDKVCLISQDF GYTIYSTAVAFYIPMSVMLFMYYQIYKAARKSAAKHKFPGFPRVQPESVISLNGVVKLQK EVEECANLSRLLKHERKNISIFKREQKAATTLGIIVGAFTVCWLPFFLLSTARPFICGTS CSCIPLWVERTCLWLGYANSLINPFIYAFFNRDLRTTYRSLLQCQYRNINRKLSAAGMHE ALKLAERPERSEFVLQNSDHCGKKGHDT
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Rat
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for Htr7 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
48,428 Da
NCBI Official Full Name
5-hydroxytryptamine receptor 7
NCBI Official Synonym Full Names
5-hydroxytryptamine (serotonin) receptor 7, adenylate cyclase-coupled
NCBI Official Symbol
Htr7
NCBI Official Synonym Symbols
5Ht7
NCBI Protein Information
5-hydroxytryptamine receptor 7
UniProt Protein Name
5-hydroxytryptamine receptor 7
UniProt Gene Name
Htr7
UniProt Synonym Gene Names
5-HT-7; 5-HT7
UniProt Entry Name
5HT7R_RAT

NCBI Description

receptor for 5-hydroxytryptamine; involved in modulatory action on cerebellar function [RGD, Feb 2006]

Uniprot Description

5-HT(7): This is one of the several different receptors for 5- hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. The activity of this receptor is mediated by G proteins that stimulate adenylate cyclase. Belongs to the G-protein coupled receptor 1 family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Receptor, GPCR; GPCR, family 1; Membrane protein, integral; Membrane protein, multi-pass

Cellular Component: cell soma; dendrite; integral to membrane; integral to plasma membrane; nerve terminal; plasma membrane; rough endoplasmic reticulum; synaptic vesicle

Molecular Function: neurotransmitter receptor activity; serotonin receptor activity

Biological Process: behavioral response to pain; circadian rhythm; detection of mechanical stimulus involved in sensory perception of pain; G-protein signaling, coupled to cyclic nucleotide second messenger; memory; micturition; negative regulation of circadian sleep/wake cycle, REM sleep; negative regulation of serotonin secretion; response to corticosterone stimulus; response to electrical stimulus; serotonin receptor signaling pathway; serotonin receptor, adenylate cyclase activating pathway; smooth muscle contraction; synaptic transmission; urinary bladder smooth muscle contraction; vasoconstriction

Research Articles on Htr7

Similar Products

Product Notes

The Htr7 htr7 (Catalog #AAA7017323) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-448aa; Full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the Htr7 htr7 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MMDVNSSGRP DLYGHLRSLI LPEVGRGLQD LSPDGGAHPV VSSWMPHLLS GFLEVTASPA PTWDAPPDNV SGCGEQINYG RVEKVVIGSI LTLITLLTIA GNCLVVISVC FVKKLRQPSN YLIVSLALAD LSVAVAVMPF VSVTDLIGGK WIFGHFFCNV FIAMDVMCCT ASIMTLCVIS IDRYLGITRP LTYPVRQNGK CMAKMILSVW LLSASITLPP LFGWAQNVND DKVCLISQDF GYTIYSTAVA FYIPMSVMLF MYYQIYKAAR KSAAKHKFPG FPRVQPESVI SLNGVVKLQK EVEECANLSR LLKHERKNIS IFKREQKAAT TLGIIVGAFT VCWLPFFLLS TARPFICGTS CSCIPLWVER TCLWLGYANS LINPFIYAFF NRDLRTTYRS LLQCQYRNIN RKLSAAGMHE ALKLAERPER SEFVLQNSDH CGKKGHDT. It is sometimes possible for the material contained within the vial of "5-hydroxytryptamine receptor 7 (Htr7), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.