Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

5-hydroxytryptamine receptor 4 (HTR4) Recombinant Protein | Htr4 recombinant protein

Recombinant Guinea pig 5-hydroxytryptamine receptor 4 (HTR4)

Gene Names
Htr4; 5-HT4S
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
5-hydroxytryptamine receptor 4 (HTR4); Recombinant Guinea pig 5-hydroxytryptamine receptor 4 (HTR4); Recombinant 5-hydroxytryptamine receptor 4 (HTR4); 5-hydroxytryptamine receptor 4; 5-HT-4; 5-HT4; Serotonin receptor 4; Htr4 recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-388
Sequence
MDKLDANVSSKEGFGSVEKVVLLTFLSAVILMAILGNLLVMVAVCRDRQLRKIKTNYFIVSLAFADLLVSVLVMPFGAIELVQDIWVYGEMFCLVRTSLDVLLTTASIFHLCCISLDRYYAICCQPLVYRNKMTPLRIALMLGGCWVIPMFISFLPIMQGWNNIGIVDLIEKRKFNQNSNSTYCVFMVNKPYAITCSVVAFYIPFLLMVLAYYRIYVTAKEHARQIQVLQRAGAPAEGRPQPADQHSTHRMRTETKAAKTLCIIMGCFCLCWAPFFVTNIVDPFIDYTVPGQLWTAFLWLGYINSGLNPFLYAFLNKSFRRAFLIILCCDDERYRRPSILGQTVPCSTTTINGSTHVLRDTVECGGQWESQCHPAASSPLVAAQPIDT
Sequence Length
388
Species
Cavia porcellus (Guinea pig)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
43,726 Da
NCBI Official Full Name
5-hydroxytryptamine receptor 4
NCBI Official Symbol
Htr4
NCBI Official Synonym Symbols
5-HT4S
NCBI Protein Information
5-hydroxytryptamine receptor 4; 5-HT4; 5-HT-4; serotonin receptor 4
UniProt Protein Name
5-hydroxytryptamine receptor 4
UniProt Gene Name
HTR4
UniProt Synonym Gene Names
5-HT-4; 5-HT4
UniProt Entry Name
5HT4R_CAVPO

Uniprot Description

Function: This is one of the several different receptors for 5-hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. The activity of this receptor is mediated by G proteins that stimulate adenylate cyclase

By similarity.

Subunit structure: May interact with INADL, MAGI2, MPP3, NOS1, SLC9A3R1, SEC23A and SNX27. May form a complex including SLC9A3R1 and EZR

By similarity. Interacts (via C-terminus 330-346 AA) with GRK5; this interaction is promoted by 5-HT (serotonin)

By similarity.

Subcellular location: Cell membrane; Multi-pass membrane protein. Endosome. Note: Interaction with SNX27 mediates recruitment to early endosomes, while interaction with SLC9A3R1 and EZR might target the protein to specialized subcellular regions, such as microvilli

By similarity.

Sequence similarities: Belongs to the G-protein coupled receptor 1 family.

Research Articles on Htr4

Similar Products

Product Notes

The Htr4 htr4 (Catalog #AAA1240742) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-388. The amino acid sequence is listed below: MDKLDANVSS KEGFGSVEKV VLLTFLSAVI LMAILGNLLV MVAVCRDRQL RKIKTNYFIV SLAFADLLVS VLVMPFGAIE LVQDIWVYGE MFCLVRTSLD VLLTTASIFH LCCISLDRYY AICCQPLVYR NKMTPLRIAL MLGGCWVIPM FISFLPIMQG WNNIGIVDLI EKRKFNQNSN STYCVFMVNK PYAITCSVVA FYIPFLLMVL AYYRIYVTAK EHARQIQVLQ RAGAPAEGRP QPADQHSTHR MRTETKAAKT LCIIMGCFCL CWAPFFVTNI VDPFIDYTVP GQLWTAFLWL GYINSGLNPF LYAFLNKSFR RAFLIILCCD DERYRRPSIL GQTVPCSTTT INGSTHVLRD TVECGGQWES QCHPAASSPL VAAQPIDT. It is sometimes possible for the material contained within the vial of "5-hydroxytryptamine receptor 4 (HTR4), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.