Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

5-hydroxytryptamine receptor 3A (HTR3A) Recombinant Protein | HTR3A recombinant protein

Recombinant Human 5-hydroxytryptamine receptor 3A (HTR3A)

Gene Names
HTR3A; HTR3; 5HT3R; 5-HT-3; 5-HT3A; 5-HT3R
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
5-hydroxytryptamine receptor 3A (HTR3A); Recombinant Human 5-hydroxytryptamine receptor 3A (HTR3A); HTR3A recombinant protein
Ordering
For Research Use Only!
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
24-478aa; Full length protein
Sequence
RRSRNTTRPALLRLSDYLLTNYRKGVRPVRDWRKPTTVSIDVIVYAILNVDEKNQVLTTY IWYRQYWTDEFLQWNPEDFDNITKLSIPTDSIWVPDILINEFVDVGKSPNIPYVYIRHQG EVQNYKPLQVVTACSLDIYNFPFDVQNCSLTFTSWLHTIQDINISLWRLPEKVKSDRSVF MNQGEWELLGVLPYFREFSMESSNYYAEMKFYVVIRRRPLFYVVSLLLPSIFLMVMDIVG FYLPPNSGERVSFKITLLLGYSVFLIIVSDTLPATAIGTPLIGVYFVVCMALLVISLAET IFIVRLVHKQDLQQPVPAWLRHLVLERIAWLLCLREQSTSQRPPATSQATKTDDCSAMGN HCSHMGGPQDFEKSPRDRCSPPPPPREASLAVCGLLQELSSIRQFLEKRDEIREVARDWL RVGSVLDKLLFHIYLLAVLAYSITLVMLWSIWQYA
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Human
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for HTR3A recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
59,002 Da
NCBI Official Full Name
5-hydroxytryptamine receptor 3A isoform b
NCBI Official Synonym Full Names
5-hydroxytryptamine receptor 3A
NCBI Official Symbol
HTR3A
NCBI Official Synonym Symbols
HTR3; 5HT3R; 5-HT-3; 5-HT3A; 5-HT3R
NCBI Protein Information
5-hydroxytryptamine receptor 3A
UniProt Protein Name
5-hydroxytryptamine receptor 3A
UniProt Gene Name
HTR3A
UniProt Synonym Gene Names
5HT3R; HTR3; 5-HT3-A; 5-HT3A; 5-HT-3; 5-HT3R
UniProt Entry Name
5HT3A_HUMAN

NCBI Description

The product of this gene belongs to the ligand-gated ion channel receptor superfamily. This gene encodes subunit A of the type 3 receptor for 5-hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. This receptor causes fast, depolarizing responses in neurons after activation. It appears that the heteromeric combination of A and B subunits is necessary to provide the full functional features of this receptor, since either subunit alone results in receptors with very low conductance and response amplitude. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Jul 2008]

Uniprot Description

5-HT(3): This is one of the several different receptors for 5- hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. This receptor is a ligand-gated ion channel, which when activated causes fast, depolarizing responses in neurons. It is a cation-specific, but otherwise relatively nonselective, ion channel. Belongs to the ligand-gated ion channel (TC 1.A.9) family. 5-hydroxytryptamine receptor (TC 1.A.9.2) subfamily. HTR3A sub-subfamily. 4 isoforms of the human protein are produced by alternative splicing.

Protein type: Channel, cation; Membrane protein, integral; Channel, ligand-gated; Transporter, ion channel; Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: 11q23.1

Cellular Component: axon; cell junction; cell soma; cytoplasm; integral to plasma membrane; nicotinic acetylcholine-gated receptor-channel complex; plasma membrane; postsynaptic membrane

Molecular Function: acetylcholine binding; acetylcholine receptor activity; nicotinic acetylcholine-activated cation-selective channel activity; protein binding; receptor activity; serotonin binding; serotonin receptor activity; serotonin-activated cation-selective channel activity; voltage-gated potassium channel activity

Biological Process: digestion; response to cocaine; response to ethanol; serotonin receptor signaling pathway; synaptic transmission; synaptic transmission, cholinergic; transport

Research Articles on HTR3A

Similar Products

Product Notes

The HTR3A htr3a (Catalog #AAA7017297) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 24-478aa; Full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the HTR3A htr3a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: RRSRNTTRPA LLRLSDYLLT NYRKGVRPVR DWRKPTTVSI DVIVYAILNV DEKNQVLTTY IWYRQYWTDE FLQWNPEDFD NITKLSIPTD SIWVPDILIN EFVDVGKSPN IPYVYIRHQG EVQNYKPLQV VTACSLDIYN FPFDVQNCSL TFTSWLHTIQ DINISLWRLP EKVKSDRSVF MNQGEWELLG VLPYFREFSM ESSNYYAEMK FYVVIRRRPL FYVVSLLLPS IFLMVMDIVG FYLPPNSGER VSFKITLLLG YSVFLIIVSD TLPATAIGTP LIGVYFVVCM ALLVISLAET IFIVRLVHKQ DLQQPVPAWL RHLVLERIAW LLCLREQSTS QRPPATSQAT KTDDCSAMGN HCSHMGGPQD FEKSPRDRCS PPPPPREASL AVCGLLQELS SIRQFLEKRD EIREVARDWL RVGSVLDKLL FHIYLLAVLA YSITLVMLWS IWQYA. It is sometimes possible for the material contained within the vial of "5-hydroxytryptamine receptor 3A (HTR3A), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.