Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

3 beta-hydroxysteroid dehydrogenase type 7 (Hsd3b7) Recombinant Protein | Hsd3b7 recombinant protein

Recombinant Rat 3 beta-hydroxysteroid dehydrogenase type 7 (Hsd3b7)

Gene Names
Hsd3b7; Cca2
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
3 beta-hydroxysteroid dehydrogenase type 7 (Hsd3b7); Recombinant Rat 3 beta-hydroxysteroid dehydrogenase type 7 (Hsd3b7); Hsd3b7 recombinant protein
Ordering
For Research Use Only!
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-338aa; Full length protein
Sequence
MADSAQVPALVYLVTGGCGFLGEHIVRMLLEWEPRLRELRVFDLHLSSWLEELKTGPVQV TAIQGDVTQAHEVAAAMAGSHVVIHTAGLVDVFGKASPETIHKVNVQGTQNVIDACVQTG TRLLVYTSSMEVVGPNVKGHPFYRGNEDTPYEAIHRHPYPCSKALAEQLVLEANGRKGLR FGGRLFRAIPASVEHGRVYVGNVAWMHILVARELEQRAALMGGQVYFCYDKSPYKSYEDF NMEFLSPCGLRLIGTHPLLPYWLLVLLTALNALLQWLLRPLVLYTPLLNPYTLAVANTTF TVSTNKAQRHFGYKPLFSWEESRARTIHWVQAMEGSAW
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Rat
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for Hsd3b7 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
37,781 Da
NCBI Official Full Name
3 beta-hydroxysteroid dehydrogenase type 7
NCBI Official Synonym Full Names
hydroxy-delta-5-steroid dehydrogenase, 3 beta- and steroid delta-isomerase 7
NCBI Official Symbol
Hsd3b7
NCBI Official Synonym Symbols
Cca2
NCBI Protein Information
3 beta-hydroxysteroid dehydrogenase type 7
UniProt Protein Name
3 beta-hydroxysteroid dehydrogenase type 7
UniProt Gene Name
Hsd3b7
UniProt Synonym Gene Names
3-beta-HSD VII; C(27) 3-beta-HSD
UniProt Entry Name
3BHS7_RAT

NCBI Description

protein that is expressed in under growth-arrest conditions [RGD, Feb 2006]

Uniprot Description

HSD3B7: The 3-beta-HSD enzymatic system plays a crucial role in the biosynthesis of all classes of hormonal steroids. HSD VII is active against four 7-alpha-hydroxylated sterols. Does not metabolize several different C(19/21) steroids as substrates. Involved in bile acid synthesis. Defects in HSD3B7 are the cause of congenital bile acid synthesis defect type 1 (CBAS1); also known as neonatal progressive intrahepatic cholestasis. CBAS1 is due to a primary defect in bile synthesis leading to progressive liver disease. Clinical features include neonatal jaundice, severe intrahepatic cholestasis and cirrhosis. Belongs to the 3-beta-HSD family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral; Lipid Metabolism - primary bile acid biosynthesis; Oxidoreductase; Membrane protein, multi-pass; EC 1.1.1.181

Cellular Component: endoplasmic reticulum membrane; integral to membrane; intracellular membrane-bound organelle

Molecular Function: 3-beta-hydroxy-delta5-steroid dehydrogenase activity; cholest-5-ene-3-beta,7-alpha-diol 3-beta-dehydrogenase activity; isomerase activity

Biological Process: bile acid metabolic process; cholesterol catabolic process; regulation of cell growth; steroid biosynthetic process

Research Articles on Hsd3b7

Similar Products

Product Notes

The Hsd3b7 hsd3b7 (Catalog #AAA7016809) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-338aa; Full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the Hsd3b7 hsd3b7 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MADSAQVPAL VYLVTGGCGF LGEHIVRMLL EWEPRLRELR VFDLHLSSWL EELKTGPVQV TAIQGDVTQA HEVAAAMAGS HVVIHTAGLV DVFGKASPET IHKVNVQGTQ NVIDACVQTG TRLLVYTSSM EVVGPNVKGH PFYRGNEDTP YEAIHRHPYP CSKALAEQLV LEANGRKGLR FGGRLFRAIP ASVEHGRVYV GNVAWMHILV ARELEQRAAL MGGQVYFCYD KSPYKSYEDF NMEFLSPCGL RLIGTHPLLP YWLLVLLTAL NALLQWLLRP LVLYTPLLNP YTLAVANTTF TVSTNKAQRH FGYKPLFSWE ESRARTIHWV QAMEGSAW. It is sometimes possible for the material contained within the vial of "3 beta-hydroxysteroid dehydrogenase type 7 (Hsd3b7), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.