3 beta-hydroxysteroid dehydrogenase type 5 (Hsd3b5) Recombinant Protein | Hsd3b5 recombinant protein

Recombinant Mouse 3 beta-hydroxysteroid dehydrogenase type 5 (Hsd3b5)

Cat. Num. AAA7016803

• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: 3 beta-hydroxysteroid dehydrogenase type 5 (Hsd3b5); Recombinant Mouse 3 beta-hydroxysteroid dehydrogenase type 5 (Hsd3b5); Hsd3b5 recombinant protein

• Host: Cell Free Expression
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Liquid containing glycerol
• Sequence Positions: 2-373aa; full length protein
• Sequence: PGWSCLVTGAGGFLGQRIVRMLVQEEELQEIRALFRTFGRKHEEELSKLQTKAKVRVLKG DILDAQCLKRACQGMSAVIHTAAAIDPLGAASRQTILDVNLKGTQLLLDACVEASVPTFI YSSSVLVAGPNSYKEIILNAHEEEHRESTWPNPYPYSKRMAEKAVLATNGRLLKNGGTLH TCALRLPFIYGEECQVTSTTVKTALKNNSIIKKNATFSIANPVYVGNAAWAHILAARSLQ DPKKSPSIQGQFYYISDNTPHQSYDDLNYTLSKEWGLCLDSGWSLPLSLLYWLAFLLETV SFLLRPVYNYRPPFNRLLITVLNSVFTISYKKAQRDLGYQPLVSWEEAKQKTSEWIGTLV KQHRETLHKKSQ
• Sequence Length: Full length protein

• Application Notes: This is a recombinant transmembrane protein expressed in a cell-free expression system.
• Species: Mouse
• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.; Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.

Product Categories/Family for Hsd3b5 recombinant protein

Transmembrane Protein

NCBI and Uniprot Product Information

• NCBI GI #: 113680667
• NCBI GeneID: 15496
• NCBI Accession #: NP_032321.2
• NCBI GenBank Nucleotide #: NM_008295.2
• UniProt Accession #: Q61694; Q91X27
• Molecular Weight: 41,892 Da
• NCBI Official Full Name: 3 beta-hydroxysteroid dehydrogenase type 5
• NCBI Official Synonym Full Names: hydroxy-delta-5-steroid dehydrogenase, 3 beta- and steroid delta-isomerase 5
• NCBI Official Symbol: Hsd3b5
• NCBI Protein Information: 3 beta-hydroxysteroid dehydrogenase type 5
• UniProt Protein Name: 3 beta-hydroxysteroid dehydrogenase type 5
• Protein Family: 3 beta-hydroxysteroid dehydrogenase
• UniProt Gene Name: Hsd3b5
• UniProt Synonym Gene Names: 3-beta-HSD V
• UniProt Entry Name: 3BHS5_MOUSE

Uniprot Description

HSD3B5: The 3-beta-HSD enzymatic system plays a crucial role in the biosynthesis of all classes of hormonal steroids. HSD V can only catalyze the conversion of dihydrotestosterone to 5 alpha- androstanediol in the presence of the cofactor NADPH. Does not function as a isomerase. Belongs to the 3-beta-HSD family.

Protein type: Mitochondrial; Membrane protein, integral; EC 1.1.1.-; Oxidoreductase

Cellular Component: endoplasmic reticulum; integral to membrane; intracellular membrane-bound organelle; membrane; mitochondrial inner membrane; mitochondrion

Molecular Function: (R)-2-hydroxyglutarate dehydrogenase activity; (R)-2-hydroxyisocaproate dehydrogenase activity; 2-hydroxytetrahydrofuran dehydrogenase activity; 3-beta-hydroxy-delta5-steroid dehydrogenase activity; 3-ketoglucose-reductase activity; 5-exo-hydroxycamphor dehydrogenase activity; acetoin dehydrogenase activity; aldo-keto reductase activity; arabinose reductase activity; C-3 sterol dehydrogenase (C-4 sterol decarboxylase) activity; D-arabinitol dehydrogenase (NADP+) activity; epoxide dehydrogenase activity; gluconate dehydrogenase activity; isocitrate dehydrogenase activity; mevaldate reductase activity; NAD binding; oxidoreductase activity; oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor; phenylcoumaran benzylic ether reductase activity; steroid binding; steroid dehydrogenase activity; steroid dehydrogenase activity, acting on the CH-CH group of donors; steroid dehydrogenase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor; xylose reductase activity

Biological Process: steroid biosynthetic process