Heat shock factor-binding protein 1 Recombinant Protein | HSBP1 recombinant protein

Recombinant Human Heat shock factor-binding protein 1

Cat. Num. AAA1265123

• Gene Names: HSBP1; NPC-A-13
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Heat shock factor-binding protein 1; Recombinant Human Heat shock factor-binding protein 1; Nasopharyngeal carcinoma-associated antigen 13; NPC-A-13; HSBP1 recombinant protein

• Host: E Coli
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Liquid containing glycerol
• Sequence Positions: 1-75aa; Partial
• Sequence: MAETDPKTVQDLTSVVQTLLQQMQDKFQTMSDQIIGRIDDMSSRIDDLEKNIADLMTQAGVEELESENKIPATQK
• Sequence Length: 76

• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

Related Product Information for HSBP1 recombinant protein

Negative regulator of the heat shock response. Negatively affects HSF1 DNA-binding activity. May have a role in the suppression of the activation of the stress response during the aging process.

Product Categories/Family for HSBP1 recombinant protein

Epigenetics and Nuclear Signaling

References

Negative regulation of the heat shock transcriptional response by HSBP1.Satyal S.H., Chen D., Fox S.G., Kramer J.M., Morimoto R.I.Genes Dev. 12:1962-1974(1998) Construction of cDNA expression library from nasopharyngeal carcinoma tissue and screening of antigenic genes.Shu J., Li G., He X.The full-ORF clone resource of the German cDNA consortium.Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I.BMC Genomics 8:399-399(2007) A quantitative atlas of mitotic phosphorylation.Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P.Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) Crystal structure of the hexamer of human heat shock factor binding protein 1.Liu X., Xu L., Liu Y., Tong X., Zhu G., Zhang X.C., Li X., Rao Z.Proteins 75:1-11(2009)

NCBI and Uniprot Product Information

• NCBI GI #: 4557647
• NCBI GeneID: 3281
• NCBI Accession #: NP_001528.1
• NCBI GenBank Nucleotide #: NM_001537.3
• UniProt Accession #: O75506; Q53XA8; Q7Z5Z3
• Molecular Weight: 35.5 kDa
• NCBI Official Full Name: heat shock factor-binding protein 1
• NCBI Official Synonym Full Names: heat shock factor binding protein 1
• NCBI Official Symbol: HSBP1
• NCBI Official Synonym Symbols: NPC-A-13
• NCBI Protein Information: heat shock factor-binding protein 1
• UniProt Protein Name: Heat shock factor-binding protein 1
• Protein Family: Heat shock factor-binding protein
• UniProt Gene Name: HSBP1
• UniProt Synonym Gene Names: HSF1BP; NPC-A-13
• UniProt Entry Name: HSBP1_HUMAN

NCBI Description

The heat-shock response is elicited by exposure of cells to thermal and chemical stress and through the activation of HSFs (heat shock factors) results in the elevated expression of heat-shock induced genes. Heat shock factor binding protein 1 (HSBP1), is a 76-amino-acid protein that binds to heat shock factor 1(HSF1), which is a transcription factor involved in the HS response. During HS response, HSF1 undergoes conformational transition from an inert non-DNA-binding monomer to active functional trimers. HSBP1 is nuclear-localized and interacts with the active trimeric state of HSF1 to negatively regulate HSF1 DNA-binding activity. Overexpression of HSBP1 in mammalian cells represses the transactivation activity of HSF1. When overexpressed in C.elegans HSBP1 has severe effects on survival of the animals after thermal and chemical stress consistent with a role of HSBP1 as a negative regulator of heat shock response. [provided by RefSeq, Jul 2008]

Uniprot Description

HSBP1: Negative regulator of the heat shock response. Negatively affects HSF1 DNA-binding activity. May have a role in the suppression of the activation of the stress response during the aging process. Belongs to the HSBP1 family.

Chromosomal Location of Human Ortholog: 16q23.3

Cellular Component: cytoskeleton; nucleoplasm; nucleus

Molecular Function: protein binding; transcription corepressor activity

Biological Process: muscle contraction; negative regulation of transcription from RNA polymerase II promoter