HPV16 recombinant protein
HPV16 protein
Purity
> 95% pureHPV16 protein was purified by GSH affinity chromatography technique
Synonyms
HPV16; HPV16 protein; HPV 16 protein; HPV-16 protein; Human Papilloma Virus Type 16 protein; Human Papilloma Virus Type 16 antigen; Human Papillomavirus genotype 16; Human Papillom avirus genotype 16; HPV16 recombinant protein
Host
Human
Purity/Purification
> 95% pure
HPV16 protein was purified by GSH affinity chromatography technique
HPV16 protein was purified by GSH affinity chromatography technique
Form/Format
Supplied as a clear liquid with 1xPBS, 40mM arginine and 0.02% sodium azide
Sequence
Amino Acid Sequence: MQVTFIYILVITCYENDVNVYHIFFQMSLWLPSEATVYLPPVPVSKVVSTDEYVARTN IYYHAGTSRLLAVGHPYFPIKKPNNNKILVPKVSGLQYRVFRIHLPDPNKFGFPDTSF YNPDTQRLVWACVGVEVGRGQPLGVGISGHPLLNKLDDTENASAYAANAGVDNRECIS MDYKQTQLCLIGCKPPIGEHWGKGSPCTNVAVNPGDCPPLELINTVIQDGDMVHTGFG AMDFTTLQANKSEVPLDICTSICKYPDYIKMVSEPYGDSLFFYLRREQMFVRHLFNRA GTVGENVPDDLYIKGSGSTANLASSNYFPTPSGSMVTSDAQIFNKPYWLQRAQGHNNG ICWGNQLFVTVVDTTRSTNMSLCAAISTSETTYKNTNFKEYLRHGEEYDLQFIFQLCK ITLTADVMTYIHSMNSTILEDWNFGLQPPPGGTLEDTYRFVTQAIACQKHTPPAPKED DPLKKYTFWEVNLKEKFSADLDQFPLGRKFLLQAGLKAKPKFTLGKRKATPTTSSTST TAKRKKRKL.
Protein Type
Recombinant
Biological Significance
Infection with specific types of HPV has been associated with an increased risk of developing cervical neoplasia. HPV types 6 and 11 have been associated with relatively benign diseases such as genital warts but types 16 and 18 are strongly associated with cervical, vaginal, and vulvar malignancies. E7-driven degradation of pRb may be involved in cervical tumorigenesis in humans.
Expression System
E Coli
Preparation and Storage
Stable at 4 degree C for 1 week, Store below -18 degree C for long term storage. Avoid freeze thaw cycles.
Related Product Information for HPV16 recombinant protein
Purified recombinant HPV16 protein
Product Categories/Family for HPV16 recombinant protein
Similar Products
Product Notes
The HPV16 (Catalog #AAA5303762) is a Recombinant Protein produced from Human and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: Amino Acid Sequence: MQVTFIYILV ITCYENDVNV YHIFFQMSLW LPSEATVYLP PVPVSKVVST DEYVARTN IYYHAGTSRL LAVGHPYFPI KKPNNNKILV PKVSGLQYRV FRIHLPDPNK FGFPDTSF YNPDTQRLVW ACVGVEVGRG QPLGVGISGH PLLNKLDDTE NASAYAANAG VDNRECIS MDYKQTQLCL IGCKPPIGEH WGKGSPCTNV AVNPGDCPPL ELINTVIQDG DMVHTGFG AMDFTTLQAN KSEVPLDICT SICKYPDYIK MVSEPYGDSL FFYLRREQMF VRHLFNRA GTVGENVPDD LYIKGSGSTA NLASSNYFPT PSGSMVTSDA QIFNKPYWLQ RAQGHNNG ICWGNQLFVT VVDTTRSTNM SLCAAISTSE TTYKNTNFKE YLRHGEEYDL QFIFQLCK ITLTADVMTY IHSMNSTILE DWNFGLQPPP GGTLEDTYRF VTQAIACQKH TPPAPKED DPLKKYTFWE VNLKEKFSAD LDQFPLGRKF LLQAGLKAKP KFTLGKRKAT PTTSSTST TAKRKKRKL. . It is sometimes possible for the material contained within the vial of "HPV16, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
