Hematopoietic prostaglandin D synthase (Hpgds) Recombinant Protein | Hpgds recombinant protein

Recombinant Mouse Hematopoietic prostaglandin D synthase (Hpgds)

Cat. Num. AAA1469460

• Gene Names: Hpgds; H-PGDS; Ptgds2
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Hematopoietic prostaglandin D synthase (Hpgds); Recombinant Mouse Hematopoietic prostaglandin D synthase (Hpgds); Hpgds recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-199, full length protein
• Sequence: MPNYKLLYFNMRGRAEIIRYIFAYLDIKYEDHRIEQADWPKIKPTLPFGKIPVLEVEGLTIHQSLAIARYLTKNTDLAGKTALEQCQADAVVDTLDDFMSLFPWAEKDQDLKERMFNELLTHQAPRLLKDLDTYLGDKEWFIGNYVTWADFYWDICSTTLLVLKPGLLDIYPKLVSLRNKVQAIPAISAWILKRPQTKL
• Sequence Length: 199

• Species: Mouse
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

• NCBI GI #: 254281300
• NCBI GeneID: 54486
• NCBI Accession #: NP_062328.3
• NCBI GenBank Nucleotide #: NM_019455.4
• UniProt Accession #: Q9JHF7; Q14AR4; Q8CA80
• Molecular Weight: 23,227 Da
• NCBI Official Full Name: hematopoietic prostaglandin D synthase
• NCBI Official Synonym Full Names: hematopoietic prostaglandin D synthase
• NCBI Official Symbol: Hpgds
• NCBI Official Synonym Symbols: H-PGDS; Ptgds2
• NCBI Protein Information: hematopoietic prostaglandin D synthase
• UniProt Protein Name: Hematopoietic prostaglandin D synthase
• Protein Family: Hematopoietic prostaglandin D synthase
• UniProt Gene Name: Hpgds
• UniProt Synonym Gene Names: Gsts; Pgds; Ptgds2; H-PGDS

Uniprot Description

Bifunctional enzyme which catalyzes both the conversion of PGH2 to PGD2, a prostaglandin involved in smooth muscle contraction/relaxation and a potent inhibitor of platelet aggregation, and the conjugation of glutathione with a wide range of aryl halides and organic isothiocyanates. Also exhibits low glutathione-peroxidase activity.