Putative DNA transport protein HofQ (hofQ) Recombinant Protein | hofQ recombinant protein
Recombinant Escherichia coli Putative DNA transport protein HofQ (hofQ)
Gene Names
hofQ; ECK3378; hopQ; JW3354
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Putative DNA transport protein HofQ (hofQ); Recombinant Escherichia coli Putative DNA transport protein HofQ (hofQ); hofQ recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
19-412, full length protein
Sequence
AKPQKVTLMVDDVPVAQVLQALAEQEKLNLVVSPDVSGTVSLHLTDVPWKQALQTVVKSAGLITRQEGNILSVHSIAWQNNNIARQEAEQARAQANLPLENRSITLQYADAGELAKAGEKLLSAKGSMTVDKRTNRLLLRDNKTALSALEQWVAQMDLPVGQVELSAHIVTINEKSLRELGVKWTLADAQHAGGVGQVTTLGSDLSVATATTHVGFNIGRINGRLLDLELSALEQKQQLDIIASPRLLASHLQPASIKQGSEIPYQVSSGESGATSVEFKEAVLGMEVTPTVLQKGRIRLKLHISQNVPGQVLQQADGEVLAIDKQEIETQVEVKSGETLALGGIFTRKNKSGQDSVPLLGDIPWFGQLFRHDGKEDERRELVVFITPRLVSSE
Sequence Length
394
Species
Escherichia coli (strain K12)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
44,716 Da
NCBI Official Full Name
DNA catabolic putative fimbrial transporter
NCBI Official Symbol
hofQ
NCBI Official Synonym Symbols
ECK3378; hopQ; JW3354
NCBI Protein Information
DNA catabolic putative fimbrial transporter
UniProt Protein Name
DNA utilization protein HofQ
Protein Family
UniProt Gene Name
hofQ
UniProt Synonym Gene Names
hopQ
NCBI Description
hofQ is a homologue of the H. influenzae competence gene comE. [More information is available at EcoCyc: EG12113].
Uniprot Description
Required for the use of extracellular DNA as a nutrient (PubMed:11591672). Could be the porin responsible for transport of DNA across the outer membrane (PubMed:16707682).
Similar Products
Product Notes
The hofQ hofq (Catalog #AAA1060792) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 19-412, full length protein. The amino acid sequence is listed below: AKPQKVTLMV DDVPVAQVLQ ALAEQEKLNL VVSPDVSGTV SLHLTDVPWK QALQTVVKSA GLITRQEGNI LSVHSIAWQN NNIARQEAEQ ARAQANLPLE NRSITLQYAD AGELAKAGEK LLSAKGSMTV DKRTNRLLLR DNKTALSALE QWVAQMDLPV GQVELSAHIV TINEKSLREL GVKWTLADAQ HAGGVGQVTT LGSDLSVATA TTHVGFNIGR INGRLLDLEL SALEQKQQLD IIASPRLLAS HLQPASIKQG SEIPYQVSSG ESGATSVEFK EAVLGMEVTP TVLQKGRIRL KLHISQNVPG QVLQQADGEV LAIDKQEIET QVEVKSGETL ALGGIFTRKN KSGQDSVPLL GDIPWFGQLF RHDGKEDERR ELVVFITPRL VSSE. It is sometimes possible for the material contained within the vial of "Putative DNA transport protein HofQ (hofQ), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
