Heterogeneous nuclear ribonucleoprotein D-like (Hnrpdl) Recombinant Protein | Hnrpdl recombinant protein
Recombinant Mouse Heterogeneous nuclear ribonucleoprotein D-like (Hnrpdl)
Gene Names
Hnrnpdl; JKTBP; Hnrpdl; AA407431; AA959857; Hnrnpdl1; hnRNP DL; hnRNP-DL; D5Wsu145e; D5Ertd650e
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Heterogeneous nuclear ribonucleoprotein D-like (Hnrpdl); Recombinant Mouse Heterogeneous nuclear ribonucleoprotein D-like (Hnrpdl); Hnrpdl recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-301, full length protein
Sequence
MEDMNEYSNIEEFAEGSKINASKNQQDDGKMFIGGLSWDTSKKDLTEYLSRFGEVVDCTIKTDPVTGRSRGFGFVLFKDAASVDKVLELKEHKLDGKLIDPKRAKALKGKEPPKKVFVGGLSPDTSEEQIKEYFGAFGEIENIELPMDTKTNERRGFCFITYTDEEPVKKLLESRYHQIGSGKCEIKVAQPKEVYRQQQQQQKGGRGAAAGGRGGARGRGRGQGQNWNQGFNNYYDQGYGNYNSAYGGDQNYSGYGGYDYTGYNYGNYGYGQGYADYSGQQSTYGKASRGGGNHQNNYQPY
Sequence Length
301
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Hnrpdl recombinant protein
This gene belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties. This protein has two RRM domains that bind to RNAs. Two alternatively spliced transcript variants have been described for this gene. One of the variants is probably not translated because the transcript is a candidate for nonsense-mediated mRNA decay. This protein is similar to its family member HNRPD.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
Molecular Weight
33,559 Da
NCBI Official Full Name
Heterogeneous nuclear ribonucleoprotein D-like
NCBI Official Synonym Full Names
heterogeneous nuclear ribonucleoprotein D-like
NCBI Official Symbol
Hnrnpdl
NCBI Official Synonym Symbols
JKTBP; Hnrpdl; AA407431; AA959857; Hnrnpdl1; hnRNP DL; hnRNP-DL; D5Wsu145e; D5Ertd650e
NCBI Protein Information
heterogeneous nuclear ribonucleoprotein D-like
UniProt Protein Name
Heterogeneous nuclear ribonucleoprotein D-like
UniProt Gene Name
Hnrnpdl
UniProt Synonym Gene Names
Hnrpdl; Jktbp; hnRNP D-like; hnRNP DL
Uniprot Description
Acts as a transcriptional regulator. Promotes transcription repression (). Promotes transcription activation in differentiated myotubes. Binds to double- and single-stranded DNA sequences (). Binds to the transcription suppressor CATR sequence of the COX5B promoter. Binds with high affinity to RNA molecules that contain AU-rich elements (AREs) found within the 3'-UTR of many proto-oncogenes and cytokine mRNAs (). Binds both to nuclear and cytoplasmic poly(A) mRNAs (). Binds to poly(G) and poly(A), but not to poly(U) or poly(C) RNA homopolymers (). Binds to the 5'-ACUAGC-3' RNA consensus sequence ().
Research Articles on Hnrpdl
Similar Products
Product Notes
The Hnrpdl hnrnpdl (Catalog #AAA1397145) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-301, full length protein. The amino acid sequence is listed below: MEDMNEYSNI EEFAEGSKIN ASKNQQDDGK MFIGGLSWDT SKKDLTEYLS RFGEVVDCTI KTDPVTGRSR GFGFVLFKDA ASVDKVLELK EHKLDGKLID PKRAKALKGK EPPKKVFVGG LSPDTSEEQI KEYFGAFGEI ENIELPMDTK TNERRGFCFI TYTDEEPVKK LLESRYHQIG SGKCEIKVAQ PKEVYRQQQQ QQKGGRGAAA GGRGGARGRG RGQGQNWNQG FNNYYDQGYG NYNSAYGGDQ NYSGYGGYDY TGYNYGNYGY GQGYADYSGQ QSTYGKASRG GGNHQNNYQP Y. It is sometimes possible for the material contained within the vial of "Heterogeneous nuclear ribonucleoprotein D-like (Hnrpdl), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
