Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

High mobility group nucleosome-binding domain-containing protein 3 (HMGN3) Recombinant Protein | HMGN3 recombinant protein

Recombinant Human High mobility group nucleosome-binding domain-containing protein 3 (HMGN3)

Gene Names
HMGN3; TRIP7; PNAS-24; PNAS-25
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
High mobility group nucleosome-binding domain-containing protein 3 (HMGN3); Recombinant Human High mobility group nucleosome-binding domain-containing protein 3 (HMGN3); HMGN3 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-99, Full length protein
Sequence
MPKRKSPENTEGKDGSKVTKQEPTRRSARLSAKPAPPKPEPKPRKTSAKKEPGAKISRGAKGKKEEKQEAGKEGTAPSENGETKAEEAQKTESVDNEGE
Sequence Length
99
Species
Human
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for HMGN3 recombinant protein
Thyroid hormone receptors are hormone-dependent transcription factors that regulate expression of a variety of specific target genes. This protein binds thyroid hormone receptor beta, but only in the presence of thyroid hormone. The encoded protein, a member of the HMGN protein family, is thought to reduce the compactness of the chromatin fiber in nucleosomes, thereby enhancing transcription from chromatin templates. Two transcript variants encoding different isoforms have been found for this gene.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
8,378 Da
NCBI Official Full Name
high mobility group nucleosome-binding domain-containing protein 3 isoform c
NCBI Official Synonym Full Names
high mobility group nucleosomal binding domain 3
NCBI Official Symbol
HMGN3
NCBI Official Synonym Symbols
TRIP7; PNAS-24; PNAS-25
NCBI Protein Information
high mobility group nucleosome-binding domain-containing protein 3
UniProt Protein Name
High mobility group nucleosome-binding domain-containing protein 3
UniProt Gene Name
HMGN3
UniProt Synonym Gene Names
TRIP7; TR-interacting protein 7; TRIP-7

NCBI Description

The protein encoded by this gene binds thyroid hormone receptor beta in the presence of thyroid hormone. The encoded protein, a member of the HMGN protein family, is thought to reduce the compactness of the chromatin fiber in nucleosomes, thereby enhancing transcription from chromatin templates. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. There is a related pseudogene on chromosome 1. [provided by RefSeq, Jan 2016]

Uniprot Description

Binds to nucleosomes, regulating chromatin structure and consequently, chromatin-dependent processes such as transcription, DNA replication and DNA repair. Affects both insulin and glucagon levels and modulates the expression of pancreatic genes involved in insulin secretion. Regulates the expression of the glucose transporter SLC2A2 by binding specifically to its promoter region and recruiting PDX1 and additional transcription factors. Regulates the expression of SLC6A9, a glycine transporter which regulates the glycine concentration in synaptic junctions in the central nervous system, by binding to its transcription start site. May play a role in ocular development and astrocyte function ().

Research Articles on HMGN3

Similar Products

Product Notes

The HMGN3 hmgn3 (Catalog #AAA1293893) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-99, Full length protein. The amino acid sequence is listed below: MPKRKSPENT EGKDGSKVTK QEPTRRSARL SAKPAPPKPE PKPRKTSAKK EPGAKISRGA KGKKEEKQEA GKEGTAPSEN GETKAEEAQK TESVDNEGE. It is sometimes possible for the material contained within the vial of "High mobility group nucleosome-binding domain-containing protein 3 (HMGN3), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.