Mouse TPR Monoclonal Antibody | anti-TPR antibody

TPR (Translocated Promoter Region (to Activated MET Oncogene)) (AP)

Cat. Num. AAA6164980

• Applications: ELISA, Western Blot
• Purity: Purified
• Synonyms: TPR; Monoclonal Antibody; TPR (Translocated Promoter Region (to Activated MET Oncogene)) (AP); Translocated Promoter Region (to Activated MET Oncogene); anti-TPR antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 1F8
• Specificity: Recognizes TPR.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).

• Applicable Applications for anti-TPR antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: TPR (NP_003283, 1aa-98aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MAAVLQQVLERTELNKLPKSVQNKLEKFLADQQSEIDGLKGRHEKFKVESEQQYFEIEKRLSHSQERLVNETRECQSLRLELEKLNNQLKALTEKNKE
• Conjugate: AP
• Preparation and Storage: Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to TPR on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to TPR on HeLa cell. [antibody concentration 10 ug/ml])

Related Product Information for anti-TPR antibody

This gene encodes a large coiled-coil protein that forms intranuclear filaments attached to the inner surface of nuclear pore complexes (NPCs). The protein directly interacts with several components of the NPC. It is required for the nuclear export of mRNAs and some proteins. Oncogenic fusions of the 5' end of this gene with several different kinase genes occur in some neoplasias. [provided by RefSeq]

Product Categories/Family for anti-TPR antibody

Antibodies; Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 114155142
• NCBI GeneID: 7175
• NCBI Accession #: NP_003283
• NCBI GenBank Nucleotide #: NM_003292
• UniProt Accession #: P12270
• Molecular Weight: 267kDa
• NCBI Official Full Name: nucleoprotein TPR
• NCBI Official Synonym Full Names: translocated promoter region, nuclear basket protein
• NCBI Official Symbol: TPR
• NCBI Protein Information: nucleoprotein TPR
• UniProt Protein Name: Nucleoprotein TPR
• Protein Family: Thiol protease
• UniProt Gene Name: TPR

NCBI Description

This gene encodes a large coiled-coil protein that forms intranuclear filaments attached to the inner surface of nuclear pore complexes (NPCs). The protein directly interacts with several components of the NPC. It is required for the nuclear export of mRNAs and some proteins. Oncogenic fusions of the 5' end of this gene with several different kinase genes occur in some neoplasias. [provided by RefSeq, Jul 2008]

Uniprot Description

TPR: a large coiled-coil nuclear pore protein that forms filamentous structures extending from nuclear pore complexes (NPCs) into the perinucleolar region. Together with Lamina-associated polypeptide 2 (LAP2) family members and Nup153, forms structural links between the nuclear lamina and the internal nuclear matrix. In interphase, localizes to the nucleoplasmic side of the nuclear pore complex (NPC) core structure, forming a fibrous structure called the nuclear basket. Essential for normal nucleocytoplasmic transport of proteins and mRNAs, plays a role in the establishment of nuclear-peripheral chromatin compartmentalization in interphase, and in the mitotic spindle checkpoint signaling during mitosis. Involved in the quality control and retention of unspliced mRNAs in the nucleus. Involved in the formation and/or maintenance of NPC-associated perinuclear heterochromatin exclusion zones (HEZs). Implicated in nuclear export of mRNAs transcribed from heat shock gene promoters; associates both with chromatin in the HSP70 promoter and with mRNAs transcribed from this promoter under stress-induced conditions. Translocations between human TPR and TrkA, MET, and RAF genes are oncogenic. Its N-terminus is involved in activation of oncogenic kinases.

Protein type: Membrane protein, peripheral; Nuclear envelope; Nucleoporin; Oncoprotein

Chromosomal Location of Human Ortholog: 1q31.1

Cellular Component: cytoplasm; cytoplasmic dynein complex; extrinsic to membrane; kinetochore; nuclear envelope; nuclear inclusion body; nuclear membrane; nuclear pore; nucleoplasm; nucleus

Molecular Function: chromatin binding; heat shock protein binding; mitogen-activated protein kinase binding; mRNA binding; nucleocytoplasmic transporter activity; protein anchor; protein binding; protein homodimerization activity; RNA binding; transporter activity; tubulin binding

Biological Process: mitotic cell cycle spindle assembly checkpoint; mitotic nuclear envelope disassembly; mRNA export from nucleus; mRNA export from nucleus during heat stress; negative regulation of RNA export from nucleus; negative regulation of transcription from RNA polymerase II promoter; negative regulation of translational initiation; nuclear matrix organization and biogenesis; nuclear pore complex assembly; nuclear pore organization and biogenesis; nuclear translocation of MAPK; positive regulation of heterochromatin formation; positive regulation of protein export from nucleus; positive regulation of protein import into nucleus; protein export from nucleus; protein import into nucleus; protein sumoylation; regulation of protein export from nucleus; regulation of protein import into nucleus; regulation of protein stability; RNA export from nucleus; RNA import into nucleus; tRNA export from nucleus; viral reproduction; viral transcription