High mobility group B protein 5 (HMGB5) Recombinant Protein | HMGB5 recombinant protein
Recombinant Arabidopsis thaliana High mobility group B protein 5 (HMGB5)
Gene Names
HMGB5; F8D20.80; F8D20_80; high mobility group B5; HMGD; NFD05; NFD5; NUCLEOSOME/CHROMATIN ASSEMBLY FACTOR 5
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
High mobility group B protein 5 (HMGB5); Recombinant Arabidopsis thaliana High mobility group B protein 5 (HMGB5); HMGB5 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-125, Full length protein
Sequence
MKDNQTEVESRSTDDRLKVRGNKVGKKTKDPNRPKKPPSPFFVFLDDFRKEFNLANPDNKSVGNVGRAAGKKWKTMTEEERAPFVAKSQSKKTEYAVTMQQYNMELANGNKTTGDDEKQEKAADD
Sequence Length
125
Species
Arabidopsis thaliana (Mouse-ear cress)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
14,203 Da
NCBI Official Full Name
high mobility group B5
NCBI Official Symbol
HMGB5
NCBI Official Synonym Symbols
F8D20.80; F8D20_80; high mobility group B5; HMGD; NFD05; NFD5; NUCLEOSOME/CHROMATIN ASSEMBLY FACTOR 5
NCBI Protein Information
high mobility group B5
UniProt Protein Name
High mobility group B protein 5
Protein Family
UniProt Gene Name
HMGB5
UniProt Synonym Gene Names
HMGD; HMGDELTA; NFD05; NFD5; AtHMGdelta; HMG delta; Nucleosome/chromatin assembly factor group D 5
NCBI Description
Encodes a protein belonging to the subgroup of HMGB (high mobility group B) proteins that have a distinctive DNA-binding motif, the HMG-box domain. The motif confers non-sequence specific interaction with linear DNA and structure-specific binding to distorted DNA sites. The HMGB proteins are involved in the assembly of nucleoprotein complexes. Cannot be phosphorylated by CK2alpha.
Uniprot Description
Binds preferentially double-stranded DNA. Confers resistance to salt and drought stresses.
Research Articles on HMGB5
Similar Products
Product Notes
The HMGB5 hmgb5 (Catalog #AAA1153183) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-125, Full length protein. The amino acid sequence is listed below: MKDNQTEVES RSTDDRLKVR GNKVGKKTKD PNRPKKPPSP FFVFLDDFRK EFNLANPDNK SVGNVGRAAG KKWKTMTEEE RAPFVAKSQS KKTEYAVTMQ QYNMELANGN KTTGDDEKQE KAADD. It is sometimes possible for the material contained within the vial of "High mobility group B protein 5 (HMGB5), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
