Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-PAGE

High mobility group protein B1 Recombinant Protein | HMGB1 recombinant protein

Recombinant Human High mobility group protein B1

Gene Names
HMGB1; HMG1; HMG3; HMG-1; SBP-1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
High mobility group protein B1; Recombinant Human High mobility group protein B1; High mobility group protein 1; HMG-1; HMGB1 recombinant protein
Ordering
For Research Use Only!
Host
E Coli
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
8-179. Partial.
Sequence
KPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAE
Sequence Length
179
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

SDS-PAGE
Related Product Information for HMGB1 recombinant protein
DNA binding proteins that associates with chromatin and has the ability to bend DNA. Binds preferentially single-stranded DNA. Involved in V(D)J recombination by acting as a cofactor of the RAG complex. Acts by stimulating cleavage and RAG protein binding at the 23 bp spacer of conserved recombination signal sequences (RSS). Heparin-binding protein that has a role in the extension of neurite-type cytoplasmic processes in developing cells.
Product Categories/Family for HMGB1 recombinant protein
References
A human placental cDNA clone that encodes nonhistone chromosomal protein HMG-1.Wen L., Huang J.K., Johnson B.H., Reeck G.R.Nucleic Acids Res. 17:1197-1214(1989)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
47.1kD
NCBI Official Full Name
high mobility group protein B1
NCBI Official Synonym Full Names
high mobility group box 1
NCBI Official Symbol
HMGB1
NCBI Official Synonym Symbols
HMG1; HMG3; HMG-1; SBP-1
NCBI Protein Information
high mobility group protein B1
UniProt Protein Name
High mobility group protein B1
UniProt Gene Name
HMGB1
UniProt Synonym Gene Names
HMG1; HMG-1
UniProt Entry Name
HMGB1_HUMAN

NCBI Description

This gene encodes a protein that belongs to the High Mobility Group-box superfamily. The encoded non-histone, nuclear DNA-binding protein regulates transcription, and is involved in organization of DNA. This protein plays a role in several cellular processes, including inflammation, cell differentiation and tumor cell migration. Multiple pseudogenes of this gene have been identified. Alternative splicing results in multiple transcript variants that encode the same protein. [provided by RefSeq, Sep 2015]

Uniprot Description

HMGB1: DNA binding proteins that associates with chromatin and has the ability to bend DNA. Binds preferentially single-stranded DNA. Involved in V(D)J recombination by acting as a cofactor of the RAG complex. Acts by stimulating cleavage and RAG protein binding at the 23 bp spacer of conserved recombination signal sequences (RSS). Heparin-binding protein that has a role in the extension of neurite-type cytoplasmic processes in developing cells. Component of the RAG complex composed of core components RAG1 and RAG2, and associated component HMGB1 or HMGB2. Belongs to the HMGB family.

Protein type: DNA repair, damage; Nuclear receptor co-regulator

Chromosomal Location of Human Ortholog: 13q12

Cellular Component: cell surface; condensed chromosome; cytosol; early endosome; ER-Golgi intermediate compartment; extracellular region; extracellular space; nucleoplasm; nucleus; plasma membrane; transcriptional repressor complex

Molecular Function: bubble DNA binding; C-X-C chemokine binding; chemoattractant activity; cytokine activity; damaged DNA binding; DNA bending activity; double-stranded DNA binding; double-stranded RNA binding; four-way junction DNA binding; lipopolysaccharide binding; lyase activity; phosphatidylserine binding; protein binding; RAGE receptor binding; single-stranded DNA binding; single-stranded RNA binding; transcription factor activity; transcription factor binding

Biological Process: activation of innate immune response; apoptosis; apoptotic cell clearance; autophagy; base-excision repair; cell structure disassembly during apoptosis; chromatin assembly; dendritic cell chemotaxis; DNA fragmentation during apoptosis; DNA geometric change; DNA ligation during DNA repair; DNA recombination; DNA topological change; elevation of cytosolic calcium ion concentration; endothelial cell proliferation; inflammatory response; inflammatory response to antigenic stimulus; innate immune response; macrophage activation during immune response; myeloid dendritic cell activation; negative regulation of blood vessel endothelial cell migration; negative regulation of CD4-positive, alpha beta T cell differentiation; negative regulation of interferon-gamma production; negative regulation of transcription from RNA polymerase II promoter; negative regulation of transcriptional preinitiation complex assembly; neurite development; plasmacytoid dendritic cell activation; positive chemotaxis; positive regulation of activated T cell proliferation; positive regulation of apoptosis; positive regulation of caspase activity; positive regulation of DNA binding; positive regulation of DNA ligation; positive regulation of interferon-alpha production; positive regulation of interferon-beta production; positive regulation of interleukin-1 beta secretion; positive regulation of interleukin-1 secretion; positive regulation of interleukin-10 production; positive regulation of interleukin-12 production; positive regulation of JNK cascade; positive regulation of MAPKKK cascade; positive regulation of mismatch repair; positive regulation of toll-like receptor 2 signaling pathway; positive regulation of toll-like receptor 4 signaling pathway; positive regulation of toll-like receptor 9 signaling pathway; positive regulation of transcription from RNA polymerase II promoter; positive regulation of tumor necrosis factor production; programmed cell death; regulation of autophagy; regulation of restriction endodeoxyribonuclease activity; regulation of T cell mediated immune response to tumor cell; regulation of tolerance induction; regulation of transcription from RNA polymerase II promoter; T-helper 1 cell differentiation; V(D)J recombination

Research Articles on HMGB1

Similar Products

Product Notes

The HMGB1 hmgb1 (Catalog #AAA717248) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 8-179. Partial. The amino acid sequence is listed below: KPRGKMSSYA FFVQTCREEH KKKHPDASVN FSEFSKKCSE RWKTMSAKEK GKFEDMAKAD KARYEREMKT YIPPKGETKK KFKDPNAPKR PPSAFFLFCS EYRPKIKGEH PGLSIGDVAK KLGEMWNNTA ADDKQPYEKK AAKLKEKYEK DIAAYRAKGK PDAAKKGVVK AE . It is sometimes possible for the material contained within the vial of "High mobility group protein B1, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.