Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

High-Mobility Group Box 1 Recombinant Protein | HMGB1 recombinant protein

Recombinant Human High-Mobility Group Box 1

Gene Names
HMGB1; HMG1; HMG3; SBP-1
Purity
Greater than 95.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
Synonyms
High-Mobility Group Box 1; Recombinant Human High-Mobility Group Box 1; HMGB1 Human; High-Mobility Group Box 1 Human Recombinant; HMG1; HMG3; SBP-1; Amphoterin; HMGB1; HMGB1 recombinant protein
Ordering
For Research Use Only!
Host
E Coli
Purity/Purification
Greater than 95.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
Form/Format
The HMG1 (1 mg/ml) was lyophilized after extensive dialyses against 1x PBS pH-7.4.
Sterile Filtered White lyophilized (freeze-dried) powder.
Concentration
1mg/ml (varies by lot)
Sequence
MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKEEEEDEEDEEDEEEEEDEEDEDEEEDDDDELEHHHHHH
Sequence Length
215
Solubility
It is recommended to reconstitute the lyophilized HMGB1 in sterile 18M Omega -cm H2O not less than 100 ug/ml, which can then be further diluted to other aqueous solutions.
Preparation and Storage
Lyophilized HMGB1 although stable at room temperature for 3 weeks, should be stored desiccated below -18 degree C. Upon reconstitution HMGB1 should be stored at 4 degree C between 2-7 days and for future use below -18 degree C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles.
Related Product Information for HMGB1 recombinant protein
Description: HMG1 Human Recombinant fused with 6X His tag produced in E Coli is a single, non-glycosylated, polypeptide chain containing 223 amino acids and having a molecular mass of 26 kDa.The HMGB-1 is purified by proprietary chromatographic techniques.

Introduction: High-mobility group box 1 protein (HMGB1), previously known as HMG-1 or amphoterin, is a member of the high mobility group box family of non-histone chromosomal proteins. Human HMGB1 is expressed as a 30 kDa, 215 amino acid (aa) single chain polypeptide containing three domains: two N-terminal globular, 70 aa positively charged DNA-binding domains (HMG boxes A and B), and a negatively charged 30 aa C-terminal region that contains only Asp and Glu.4, 5 Residues 27 - 43 and 178 - 184 contain a NLS. Posttranslational modifications of the molecule have been reported, with acetylation occurring on as many as 17 lysine residues. HMGB1 is expressed at high levels in almost all cells. It was originally discovered as a nuclear protein that could bend DNA. Such bending stabilizes nucleosome formation and regulates the expression of select genes upon recruitment by DNA binding proteins.
Product Categories/Family for HMGB1 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
24,894 Da
NCBI Official Full Name
high mobility group protein B1
NCBI Official Synonym Full Names
high mobility group box 1
NCBI Official Symbol
HMGB1
NCBI Official Synonym Symbols
HMG1; HMG3; SBP-1
NCBI Protein Information
high mobility group protein B1; Amphoterin; HMG-1; Sulfoglucuronyl carbohydrate binding protein; high mobility group protein 1; high-mobility group (nonhistone chromosomal) protein 1; high-mobility group box 1
UniProt Protein Name
High mobility group protein B1
UniProt Gene Name
HMGB1
UniProt Synonym Gene Names
HMG1; HMG-1
UniProt Entry Name
HMGB1_HUMAN

Uniprot Description

HMGB1: DNA binding proteins that associates with chromatin and has the ability to bend DNA. Binds preferentially single-stranded DNA. Involved in V(D)J recombination by acting as a cofactor of the RAG complex. Acts by stimulating cleavage and RAG protein binding at the 23 bp spacer of conserved recombination signal sequences (RSS). Heparin-binding protein that has a role in the extension of neurite-type cytoplasmic processes in developing cells. Component of the RAG complex composed of core components RAG1 and RAG2, and associated component HMGB1 or HMGB2. Belongs to the HMGB family.

Protein type: DNA repair, damage; Nuclear receptor co-regulator

Chromosomal Location of Human Ortholog: 13q12

Cellular Component: nucleoplasm; extracellular space; cell surface; transcriptional repressor complex; extracellular region; condensed chromosome; nucleus

Molecular Function: protein binding; RAGE receptor binding; double-stranded DNA binding; damaged DNA binding; cytokine activity; chromatin binding; DNA bending activity; transcription factor activity; transcription factor binding; single-stranded DNA binding; chemoattractant activity

Biological Process: negative regulation of transcriptional preinitiation complex assembly; V(D)J recombination; DNA topological change; positive regulation of apoptosis; apoptosis; positive regulation of caspase activity; base-excision repair, DNA ligation; negative regulation of transcription from RNA polymerase II promoter; DNA recombination; chromatin remodeling; regulation of transcription from RNA polymerase II promoter; myeloid dendritic cell activation; inflammatory response to antigenic stimulus; positive chemotaxis; innate immune response; DNA ligation during DNA repair; dendritic cell chemotaxis; positive regulation of transcription from RNA polymerase II promoter; DNA fragmentation during apoptosis; neurite development; positive regulation of DNA binding; cell structure disassembly during apoptosis

Research Articles on HMGB1

Similar Products

Product Notes

The HMGB1 hmgb1 (Catalog #AAA143251) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: MGKGDPKKPR GKMSSYAFFV QTCREEHKKK HPDASVNFSE FSKKCSERWK TMSAKEKGKF EDMAKADKAR YEREMKTYIP PKGETKKKFK DPNAPKRPPS AFFLFCSEYR PKIKGEHPGL SIGDVAKKLG EMWNNTAADD KQPYEKKAAK LKEKYEKDIA AYRAKGKPDA AKKGVVKAEK SKKKEEEEDE EDEEDEEEEE DEEDEDEEED DDDELEHHHH HH. It is sometimes possible for the material contained within the vial of "High-Mobility Group Box 1, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.