Hdr-like menaquinol oxidoreductase cytochrome b-like subunit (hmeC) Recombinant Protein | AF0501 recombinant protein
Recombinant Archaeoglobus fulgidus Hdr-like menaquinol oxidoreductase cytochrome b-like subunit (hmeC)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Hdr-like menaquinol oxidoreductase cytochrome b-like subunit (hmeC); Recombinant Archaeoglobus fulgidus Hdr-like menaquinol oxidoreductase cytochrome b-like subunit (hmeC); Recombinant Hdr-like menaquinol oxidoreductase cytochrome b-like subunit (hmeC); Hdr-like menaquinol oxidoreductase cytochrome b-like subunit; Hme subunit C; AF0501 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-332
Sequence
MIGVIFGVIVPYIAVAIFVIGVIYRIVNWANSAVPLKIPTTGGQQKSFPFIKRTIYDRFDSPYTWWETAGRMLLEIFFFRSLLKNTRYYLDRVSQKDARWLWLFGILFHYSLLLVLIRHSRFFLDPVPSFVETLSEIEAFKGVFIPSVYMSGLAIVAALFLLWLRRIFLSRERTLSLPSDHFALILLLAITISGNVMRYFVKADLFAVKELLMSLMTFNIGHAVEVANTIEPIFYVHFALASFLLAYFPFSKLMHAGGVFFSPTRNMPNDNRARRHVNPWDPADVPLLAKGITVAGRVYKSKKLDWDTYYSMYTDQLQEIEEADYKIVPEEL
Sequence Length
332
Species
Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
38,386 Da
NCBI Official Full Name
nitrate reductase, gamma subunit
NCBI Official Symbol
AF0501
NCBI Protein Information
nitrate reductase, gamma subunit
UniProt Protein Name
Hdr-like menaquinol oxidoreductase cytochrome b-like subunit
UniProt Gene Name
hmeC
UniProt Synonym Gene Names
Hme subunit C
UniProt Entry Name
HMEC_ARCFU
Uniprot Description
Function: Has menaquinol-oxidizing activity. HmeC and HmeD subunits may together mediate electron transfer from menaquinol to an unidentified electron acceptor on the cytoplasmic side of the membrane.
Subunit structure: Consists of five subunits: an integral membrane subunit, a cytochrome b-like subunit, a cytochrome c subunit and two iron-sulfur subunits.
Subcellular location: Cell membrane; Multi-pass membrane protein
Potential.
Similar Products
Product Notes
The AF0501 hmec (Catalog #AAA1218544) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-332. The amino acid sequence is listed below: MIGVIFGVIV PYIAVAIFVI GVIYRIVNWA NSAVPLKIPT TGGQQKSFPF IKRTIYDRFD SPYTWWETAG RMLLEIFFFR SLLKNTRYYL DRVSQKDARW LWLFGILFHY SLLLVLIRHS RFFLDPVPSF VETLSEIEAF KGVFIPSVYM SGLAIVAALF LLWLRRIFLS RERTLSLPSD HFALILLLAI TISGNVMRYF VKADLFAVKE LLMSLMTFNI GHAVEVANTI EPIFYVHFAL ASFLLAYFPF SKLMHAGGVF FSPTRNMPND NRARRHVNPW DPADVPLLAK GITVAGRVYK SKKLDWDTYY SMYTDQLQEI EEADYKIVPE EL. It is sometimes possible for the material contained within the vial of "Hdr-like menaquinol oxidoreductase cytochrome b-like subunit (hmeC), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
