Hemolysin secretion protein (hlyB) Recombinant Protein | hlyB recombinant protein
Recombinant Vibrio cholerae serotype O1 Hemolysin secretion protein (hlyB)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Hemolysin secretion protein (hlyB); Recombinant Vibrio cholerae serotype O1 Hemolysin secretion protein (hlyB); hlyB recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
18-548aa; full length protein
Sequence
IPAIALLFVAFTSLNTMSVMQAQSNSLYANTAAPMRAMAEATSRIPRMRVGIDMMLLQET ALKDAKGVLKRVEEARTEDIPEMRQAMQVAVDSQVNPELKEQARKLQARFEQMVREELEP MLQAFANNDMTTAQNIYRDKYAPTYGEMRKQANQILDTLLQQAEQQNHASVESFEAGRTK QMVIIAAGLIISFITSLVIITNLRSRVAYLKDRMSSAAANLSLRTRLELDGNDELCDIGK SFNAFIDKVHHSIEEVAENSKELATMASSVSQRAHMTQSNCASQRDRTVQVATAIHELGA TVSEIASNAAMAADVAKQATLHSGEGKKVVGEVQNRIQTLVNELDNATQVVSSLATQING ISSTLDTIRSISEQTNLLALNAAIEAARAGEQGRGFAVVADEVRTLASRSAASTEEIQQV INRLQTESTRAVEAMEKGRSQSDVVVEFSAKANQSLTEINSQIDQINDQNIQVATATEEQ STVVEDINRNVEDINQLTTETSHVADELSRASASLQRLSSQLDKLVGSFEL
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for hlyB recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
60,035 Da
NCBI Official Full Name
hemolysin secretion protein HylB
NCBI Official Symbol
VCA0220
NCBI Protein Information
hemolysin secretion protein HylB
UniProt Protein Name
Methyl-accepting chemotaxis protein HlyB
Protein Family
UniProt Gene Name
hlyB
UniProt Entry Name
HLYB_VIBCH
Uniprot Description
Chemotactic-signal transducers respond to changes in the concentration of attractants and repellents in the environment, transduce a signal from the outside to the inside of the cell, and facilitate sensory adaptation through the variation of the level of methylation.
Similar Products
Product Notes
The hlyB hlyb (Catalog #AAA7016626) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 18-548aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the hlyB hlyb for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: IPAIALLFVA FTSLNTMSVM QAQSNSLYAN TAAPMRAMAE ATSRIPRMRV GIDMMLLQET ALKDAKGVLK RVEEARTEDI PEMRQAMQVA VDSQVNPELK EQARKLQARF EQMVREELEP MLQAFANNDM TTAQNIYRDK YAPTYGEMRK QANQILDTLL QQAEQQNHAS VESFEAGRTK QMVIIAAGLI ISFITSLVII TNLRSRVAYL KDRMSSAAAN LSLRTRLELD GNDELCDIGK SFNAFIDKVH HSIEEVAENS KELATMASSV SQRAHMTQSN CASQRDRTVQ VATAIHELGA TVSEIASNAA MAADVAKQAT LHSGEGKKVV GEVQNRIQTL VNELDNATQV VSSLATQING ISSTLDTIRS ISEQTNLLAL NAAIEAARAG EQGRGFAVVA DEVRTLASRS AASTEEIQQV INRLQTESTR AVEAMEKGRS QSDVVVEFSA KANQSLTEIN SQIDQINDQN IQVATATEEQ STVVEDINRN VEDINQLTTE TSHVADELSR ASASLQRLSS QLDKLVGSFE L. It is sometimes possible for the material contained within the vial of "Hemolysin secretion protein (hlyB), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
