ATP-dependent RNA helicase WM6 (Hel25E) Recombinant Protein | Hel25E recombinant protein
Recombinant Drosophila melanogaster ATP-dependent RNA helicase WM6 (Hel25E)
Gene Names
Hel25E; CG7269; Dbp25F; DmelCG7269; DmRH4; hel; Hel; HEL; HEL25E; jf26; l(2)25Eb; l(2)gdh-12; l(2)gdh12; l(2)jf26; l(2)k11511; sz; uap56; UAP56; Wm6; WM6
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
ATP-dependent RNA helicase WM6 (Hel25E); Recombinant Drosophila melanogaster ATP-dependent RNA helicase WM6 (Hel25E); Hel25E recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-424, Full length protein
Sequence
MADNDDLLDYEDEEQTETTAVENQEAPKKDVKGTYVSIHSSGFRDFLLKPEILRAIVDCGFEHPSEVQHECIPQAVLGMDILCQAKSGMGKTAVFVLATLQQLEPSDNNTCHVLVMCHTRELAFQISKEYERFSKYMPTVKVAVFFGGMAIQKDEETLKSGTPHIVVGTPGRILALIRNKKLNLKLLKHFVLDECDKMLEQLDMRRDVQEIFRSTPHGKQVMMFSATLSKDIRPVCKKFMQDPMEVYVDDEAKLTLHGLQQHYVNLKENEKNKKLFELLDVLEFNQVVIFVKSVQRCVALSQLLTEQNFPAIGIHRGMTQEERLNRYQQFKDFQKRILVATNLFGRGMDIERVNIVFNYDMPEDSDTYLHRVARAGRFGTKGLAITFVSDENDAKILNEVQDRFDVNISELPEEIDLSTYIEGR
Sequence Length
424
Species
Drosophila melanogaster (Fruit fly)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
48,652 Da
NCBI Official Full Name
helicase at 25E, isoform A
NCBI Official Synonym Full Names
Helicase at 25E
NCBI Official Symbol
Hel25E
NCBI Official Synonym Symbols
CG7269; Dbp25F; DmelCG7269; DmRH4; hel; Hel; HEL; HEL25E; jf26; l(2)25Eb; l(2)gdh-12; l(2)gdh12; l(2)jf26; l(2)k11511; sz; uap56; UAP56; Wm6; WM6
NCBI Protein Information
CG7269 gene product from transcript CG7269-RC
UniProt Protein Name
ATP-dependent RNA helicase WM6
Protein Family
UniProt Gene Name
Hel25E
UniProt Synonym Gene Names
Dbp25F; hel; WM6; DEAD box protein UAP56; Dmrnahel
Uniprot Description
Required for mRNA export out of the nucleus. Probable RNA helicase that may regulate entry into mitosis by down-regulating the expression of other genes whose activity may be rate-limiting for entry into mitosis during embryogenesis. Binds to salivary gland chromosomes and modifies position effect variegation. Promotes an open chromatin structure that favors transcription during development by regulating the spread of heterochromatin.
Research Articles on Hel25E
Similar Products
Product Notes
The Hel25E hel25e (Catalog #AAA1303941) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-424, Full length protein. The amino acid sequence is listed below: MADNDDLLDY EDEEQTETTA VENQEAPKKD VKGTYVSIHS SGFRDFLLKP EILRAIVDCG FEHPSEVQHE CIPQAVLGMD ILCQAKSGMG KTAVFVLATL QQLEPSDNNT CHVLVMCHTR ELAFQISKEY ERFSKYMPTV KVAVFFGGMA IQKDEETLKS GTPHIVVGTP GRILALIRNK KLNLKLLKHF VLDECDKMLE QLDMRRDVQE IFRSTPHGKQ VMMFSATLSK DIRPVCKKFM QDPMEVYVDD EAKLTLHGLQ QHYVNLKENE KNKKLFELLD VLEFNQVVIF VKSVQRCVAL SQLLTEQNFP AIGIHRGMTQ EERLNRYQQF KDFQKRILVA TNLFGRGMDI ERVNIVFNYD MPEDSDTYLH RVARAGRFGT KGLAITFVSD ENDAKILNEV QDRFDVNISE LPEEIDLSTY IEGR. It is sometimes possible for the material contained within the vial of "ATP-dependent RNA helicase WM6 (Hel25E), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
