Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-Page (Recombinant Human TNFRSF17/BCMA/CD269 Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 35-45 kDa.)

TNFRSF17/BCMA/CD269 Active Protein | TNFRSF17 active protein

Recombinant Human TNFRSF17/BCMA/CD269 Protein

Gene Names
TNFRSF17; BCM; BCMA; CD269; TNFRSF13A
Purity
>92% by SDS-PAGE.
Synonyms
TNFRSF17/BCMA/CD269; Recombinant Human TNFRSF17/BCMA/CD269 Protein; BCM; BCMA; CD269; TNFRSF13A; TNFRSF17 active protein
Ordering
For Research Use Only!
Host
HEK293 Cells
Purity/Purification
>92% by SDS-PAGE.
Form/Format
Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.
Sequence
MLQMAGQCSQNEYFDSLLHACIPCQLRCSSNTPPLTCQRYCNASVTNSVKGTNA
Sequence Length
184
Species
Human
Endotoxin
< 0.1 EU/ug of the protein by LAL method.
Biological Activity
Measured by its binding ability in a functional ELISA. Immobilized recombinant human BAFF at 5 ug/mL (100 uL/well) can bind recombinant human TNFRSF17 with a linear range of 3-20 ng/mL.
Reconstitution
Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water.
Tag
Fc, 6xHis tag at the C-terminus
Preparation and Storage
Store the lyophilized protein at -20 degree C to -80 degree C for long term.
After reconstitution, the protein solution is stable at -20 degree C for 3 months, at 2-8 degree C for up to 1 week.

SDS-Page

(Recombinant Human TNFRSF17/BCMA/CD269 Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 35-45 kDa.)

SDS-Page (Recombinant Human TNFRSF17/BCMA/CD269 Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 35-45 kDa.)
Related Product Information for TNFRSF17 active protein
Description: Recombinant Human TNFRSF17/BCMA/CD269 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Met1-Ala54) of human TNFRSF17/BCMA/CD269 (Accession #NP_001183.2) fused with an Fc, 6xHis tag at the C-terminus.

Background: Tumor necrosis factor receptor superfamily, member 17 (TNFRSF17), also known as B cell maturation antigen (BCMA) or CD269 antigen, is a member of the TNF-receptor superfamily. This receptor is preferentially expressed in mature B lymphocytes, and may be important for B cell development and autoimmune response. This receptor has been shown to specifically bind to the tumor necrosis factor (ligand) superfamily, member 13b (TNFSF13B/TALL-1/BAFF), and to lead to NF-kappaB and MAPK8/JNK activation. This receptor also binds to various TRAF family members, and thus may transduce signals for cell survival and proliferation.
Product Categories/Family for TNFRSF17 active protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
608
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
tumor necrosis factor receptor superfamily member 17
NCBI Official Synonym Full Names
TNF receptor superfamily member 17
NCBI Official Symbol
TNFRSF17
NCBI Official Synonym Symbols
BCM; BCMA; CD269; TNFRSF13A
NCBI Protein Information
tumor necrosis factor receptor superfamily member 17
UniProt Protein Name
Tumor necrosis factor receptor superfamily member 17
UniProt Gene Name
TNFRSF17
UniProt Synonym Gene Names
BCM; BCMA
UniProt Entry Name
TNR17_HUMAN

NCBI Description

The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor is preferentially expressed in mature B lymphocytes, and may be important for B cell development and autoimmune response. This receptor has been shown to specifically bind to the tumor necrosis factor (ligand) superfamily, member 13b (TNFSF13B/TALL-1/BAFF), and to lead to NF-kappaB and MAPK8/JNK activation. This receptor also binds to various TRAF family members, and thus may transduce signals for cell survival and proliferation. [provided by RefSeq, Jul 2008]

Uniprot Description

TNFRSF17: Receptor for TNFSF13B/BLyS/BAFF and TNFSF13/APRIL. Promotes B-cell survival and plays a role in the regulation of humoral immunity. Activates NF-kappa-B and JNK. A chromosomal aberration involving TNFRSF17 is found in a form of T-cell acute lymphoblastic leukemia (T-ALL). Translocation t(4;16)(q26;p13) with IL2.

Protein type: Membrane protein, integral; Oncoprotein; Receptor, misc.

Chromosomal Location of Human Ortholog: 16p13.1

Cellular Component: integral to membrane; plasma membrane; endomembrane system

Molecular Function: receptor activity

Biological Process: cell proliferation; immune system process; multicellular organismal development; signal transduction

Research Articles on TNFRSF17

Similar Products

Product Notes

The TNFRSF17 tnfrsf17 (Catalog #AAA9141719) is an Active Protein produced from HEK293 Cells and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: MLQMAGQCSQ NEYFDSLLHA CIPCQLRCSS NTPPLTCQRY CNASVTNSVK GTNA. It is sometimes possible for the material contained within the vial of "TNFRSF17/BCMA/CD269, Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.