Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-Page (Recombinant Human IL10/Interleukin-10 Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 18 kDa.)

IL10/Interleukin-10 Active Protein | IL10 active protein

Recombinant Human IL10/Interleukin-10 Protein

Gene Names
IL10; CSIF; TGIF; GVHDS; IL-10; IL10A
Purity
>92% by SDS-PAGE.
Synonyms
IL10/Interleukin-10; Recombinant Human IL10/Interleukin-10 Protein; CSIF; GVHDS; IL-10; IL10A; TGIF; IL10 active protein
Ordering
For Research Use Only!
Host
HEK293 Cells
Purity/Purification
>92% by SDS-PAGE.
Form/Format
Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.
Sequence
SPGQGTQSENSCTHFPGNLPNMLRDLRDAFSRVKTFFQMKDQLDNLLLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENQDPDIKAHVNSLGENLKTLRLRLRRCHRFLPCENKSKAVEQVKNAFNKLQEKGIYKAMSEFDIFINYIEAYMTMKIRN
Sequence Length
178
Species
Human
Endotoxin
< 0.1 EU/ug of the protein by LAL method.
Biological Activity
Measured in a cell proliferation assay using MC/9-2 mouse mast cells. The ED50 for this effect is typically 0.2-1.2 ng/mL.
Reconstitution
Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water.
Tag
6xHis tag at the C-terminus
Preparation and Storage
Store the lyophilized protein at -20 degree C to -80 degree C for long term.
After reconstitution, the protein solution is stable at -20 degree C for 3 months, at 2-8 degree C for up to 1 week.

SDS-Page

(Recombinant Human IL10/Interleukin-10 Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 18 kDa.)

SDS-Page (Recombinant Human IL10/Interleukin-10 Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 18 kDa.)
Related Product Information for IL10 active protein
Description: Recombinant Human IL10/Interleukin-10 Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Ser19-Asn178) of human IL10/Interleukin-10 (Accession #NP_000563.1) fused with a 6xHis tag at the C-terminus.

Background: The protein encoded by this gene is a cytokine produced primarily by monocytes and to a lesser extent by lymphocytes. This cytokine has pleiotropic effects in immunoregulation and inflammation. It down-regulates the expression of Th1 cytokines, MHC class II Ags, and costimulatory molecules on macrophages. It also enhances B cell survival, proliferation, and antibody production. This cytokine can block NF-kappa B activity, and is involved in the regulation of the JAK-STAT signaling pathway. Knockout studies in mice suggested the function of this cytokine as an essential immunoregulator in the intestinal tract. Mutations in this gene are associated with an increased susceptibility to HIV-1 infection and rheumatoid arthritis.
Product Categories/Family for IL10 active protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
NCBI Official Full Name
Interleukin-10
NCBI Official Synonym Full Names
interleukin 10
NCBI Official Symbol
IL10
NCBI Official Synonym Symbols
CSIF; TGIF; GVHDS; IL-10; IL10A
NCBI Protein Information
interleukin-10
UniProt Protein Name
Interleukin-10
Protein Family
UniProt Gene Name
IL10
UniProt Synonym Gene Names
IL-10; CSIF
UniProt Entry Name
IL10_HUMAN

NCBI Description

The protein encoded by this gene is a cytokine produced primarily by monocytes and to a lesser extent by lymphocytes. This cytokine has pleiotropic effects in immunoregulation and inflammation. It down-regulates the expression of Th1 cytokines, MHC class II Ags, and costimulatory molecules on macrophages. It also enhances B cell survival, proliferation, and antibody production. This cytokine can block NF-kappa B activity, and is involved in the regulation of the JAK-STAT signaling pathway. Knockout studies in mice suggested the function of this cytokine as an essential immunoregulator in the intestinal tract. Mutations in this gene are associated with an increased susceptibility to HIV-1 infection and rheumatoid arthritis. [provided by RefSeq, May 2020]

Uniprot Description

IL10: Inhibits the synthesis of a number of cytokines, including IFN-gamma, IL-2, IL-3, TNF and GM-CSF produced by activated macrophages and by helper T-cells. Belongs to the IL-10 family.

Protein type: Cytokine; Motility/polarity/chemotaxis; Secreted, signal peptide; Secreted

Chromosomal Location of Human Ortholog: 1q31-q32

Cellular Component: extracellular space

Molecular Function: growth factor activity; cytokine activity; interleukin-10 receptor binding

Biological Process: negative regulation of chronic inflammatory response to antigenic stimulus; B cell proliferation; regulation of isotype switching; leukocyte chemotaxis; positive regulation of transcription, DNA-dependent; response to glucocorticoid stimulus; positive regulation of JAK-STAT cascade; negative regulation of B cell proliferation; negative regulation of membrane protein ectodomain proteolysis; response to insulin stimulus; negative regulation of interferon-alpha biosynthetic process; negative regulation of T cell proliferation; cytoplasmic sequestering of NF-kappaB; cell-cell signaling; negative regulation of interferon-gamma production; response to molecule of bacterial origin; positive regulation of MHC class II biosynthetic process; negative regulation of interleukin-6 production; negative regulation of tumor necrosis factor biosynthetic process; hemopoiesis; inflammatory response; aging; response to drug; response to inactivity; negative regulation of interleukin-12 production; positive regulation of B cell apoptosis; T-helper 2 type immune response; negative regulation of myeloid dendritic cell activation; negative regulation of nitric oxide biosynthetic process; negative regulation of cytokine secretion during immune response; regulation of gene expression; B cell differentiation; defense response to bacterium; negative regulation of MHC class II biosynthetic process; positive regulation of transcription from RNA polymerase II promoter; positive regulation of transcription factor activity; receptor biosynthetic process; response to activity; regulation of sensory perception of pain; negative regulation of apoptosis; positive regulation of cytokine secretion

Disease: Graft-versus-host Disease, Susceptibility To; Rheumatoid Arthritis; Human Immunodeficiency Virus Type 1, Susceptibility To

Research Articles on IL10

Similar Products

Product Notes

The IL10 il10 (Catalog #AAA9139690) is an Active Protein produced from HEK293 Cells and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: SPGQGTQSEN SCTHFPGNLP NMLRDLRDAF SRVKTFFQMK DQLDNLLLKE SLLEDFKGYL GCQALSEMIQ FYLEEVMPQA ENQDPDIKAH VNSLGENLKT LRLRLRRCHR FLPCENKSKA VEQVKNAFNK LQEKGIYKAM SEFDIFINYI EAYMTMKIRN. It is sometimes possible for the material contained within the vial of "IL10/Interleukin-10, Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.