Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-Page (Recombinant Human Fc gamma RIIIA/CD16a Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 45-52 kDa.)

Fc gamma RIIIA/CD16a Active Protein | CD16a active protein

Recombinant Human Fc gamma RIIIA/CD16a Protein

Gene Names
FCGR3A; CD16; FCG3; CD16A; FCGR3; IGFR3; IMD20; FCR-10; FCRIII; FCGRIII; FCRIIIA
Purity
>95% by SDS-PAGE.
Synonyms
Fc gamma RIIIA/CD16a; Recombinant Human Fc gamma RIIIA/CD16a Protein; CD16; CD16A; FCG3; FCGR3; FCGRIII; FCR-10; FCRIII; FCRIIIA; IGFR3; IMD20; CD16a active protein
Ordering
For Research Use Only!
Host
HEK293 Cells
Purity/Purification
>95% by SDS-PAGE.
Form/Format
Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.
Sequence
GMRTEDLPKAVVFLEPQWYRVLEKDSVTLKCQGAYSPEDNSTQWFHNESLISSQASSYFIDAATVDDSGEYRCQTNLSTLSDPVQLEVHIGWLLLQAPRWVFKEEDPIHLRCHSWKNTALHKVTYLQNGKGRKYFHHNSDFYIPKATLKDSGSYFCRGLFGSKNVSSETVNITITQGLAVSTISSFFPPGYQ
Sequence Length
254
Species
Human
Endotoxin
< 0.1 EU/ug of the protein by LAL method.
Biological Activity
Measured by its binding ability in a functional ELISA. Immobilized human CD16a-His at 10 ug/ml (100 ul/well) can bind biotinylated human IgG1, The EC50 of biotinylated human IgG1 is 0.90-2.30 ug/ml.
Reconstitution
Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water.
Tag
6xHis tag at the C-terminus
Preparation and Storage
Store the lyophilized protein at -20 degree C to -80 degree C for long term.
After reconstitution, the protein solution is stable at -20 degree C for 3 months, at 2-8 degree C for up to 1 week.

SDS-Page

(Recombinant Human Fc gamma RIIIA/CD16a Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 45-52 kDa.)

SDS-Page (Recombinant Human Fc gamma RIIIA/CD16a Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 45-52 kDa.)
Related Product Information for CD16a active protein
Description: Recombinant Human Fc gamma RIIIA/CD16a Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Gly17-Gln208) of human Fc gamma RIIIA/CD16a (Accession #NP_001121065.1) fused with a 6xHis tag at the C-terminus.

Background: This protein is a receptor for the Fc portion of immunoglobulin G, and it is involved in the removal of antigen-antibody complexes from the circulation, as well as other other antibody-dependent responses. The protein is expressed on natural killer (NK) cells as an integral membrane glycoprotein anchored through a transmembrane peptide, whereas FCGR3B is expressed on polymorphonuclear neutrophils (PMN) where the receptor is anchored through a phosphatidylinositol (PI) linkage. Mutations in this gene have been linked to susceptibility to recurrent viral infections, susceptibility to systemic lupus erythematosus, and alloimmune neonatal neutropenia.
Product Categories/Family for CD16a active protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
NCBI Official Full Name
Low affinity immunoglobulin gamma Fc region receptor III-A
NCBI Official Synonym Full Names
Fc fragment of IgG receptor IIIa
NCBI Official Symbol
FCGR3A
NCBI Official Synonym Symbols
CD16; FCG3; CD16A; FCGR3; IGFR3; IMD20; FCR-10; FCRIII; FCGRIII; FCRIIIA
NCBI Protein Information
low affinity immunoglobulin gamma Fc region receptor III-A
UniProt Protein Name
Low affinity immunoglobulin gamma Fc region receptor III-A
UniProt Gene Name
FCGR3A
UniProt Synonym Gene Names
CD16A; FCG3; FCGR3; IGFR3; Fc-gamma RIII; Fc-gamma RIIIa; FcRIII; FcRIIIa
UniProt Entry Name
FCG3A_HUMAN

NCBI Description

This gene encodes a receptor for the Fc portion of immunoglobulin G, and it is involved in the removal of antigen-antibody complexes from the circulation, as well as other other antibody-dependent responses. This gene (FCGR3A) is highly similar to another nearby gene (FCGR3B) located on chromosome 1. The receptor encoded by this gene is expressed on natural killer (NK) cells as an integral membrane glycoprotein anchored through a transmembrane peptide, whereas FCGR3B is expressed on polymorphonuclear neutrophils (PMN) where the receptor is anchored through a phosphatidylinositol (PI) linkage. Mutations in this gene have been linked to susceptibility to recurrent viral infections, susceptibility to systemic lupus erythematosus, and alloimmune neonatal neutropenia. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

FCGR3A: Receptor for the Fc region of IgG. Binds complexed or aggregated IgG and also monomeric IgG. Mediates antibody-dependent cellular cytotoxicity (ADCC) and other antibody-dependent responses, such as phagocytosis.

Protein type: Membrane protein, integral

Chromosomal Location of Human Ortholog: 1q23

Cellular Component: integral to membrane; plasma membrane; external side of plasma membrane

Molecular Function: IgG binding

Biological Process: regulation of immune response; innate immune response; immune response

Disease: Immunodeficiency 20

Research Articles on CD16a

Similar Products

Product Notes

The CD16a fcgr3a (Catalog #AAA9139669) is an Active Protein produced from HEK293 Cells and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: GMRTEDLPKA VVFLEPQWYR VLEKDSVTLK CQGAYSPEDN STQWFHNESL ISSQASSYFI DAATVDDSGE YRCQTNLSTL SDPVQLEVHI GWLLLQAPRW VFKEEDPIHL RCHSWKNTAL HKVTYLQNGK GRKYFHHNSD FYIPKATLKD SGSYFCRGLF GSKNVSSETV NITITQGLAV STISSFFPPG YQ. It is sometimes possible for the material contained within the vial of "Fc gamma RIIIA/CD16a, Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.