Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-Page (Recombinant Human ErbB3/Her3 Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at approximately 100 kDa.)

ErbB3/Her3 Active Protein | ErbB3 active protein

Recombinant Human ErbB3/Her3 Protein

Gene Names
ERBB3; HER3; FERLK; LCCS2; ErbB-3; c-erbB3; erbB3-S; MDA-BF-1; c-erbB-3; p180-ErbB3; p45-sErbB3; p85-sErbB3
Purity
>97% by SDS-PAGE.
Synonyms
ErbB3/Her3; Recombinant Human ErbB3/Her3 Protein; c-erbB-3; c-erbB3; ErbB-3; erbB3-S; HER3; LCCS2; MDA-BF-1; p180-ErbB3; p45-sErbB3; p85-sErbB3; ErbB3 active protein
Ordering
For Research Use Only!
Host
HEK293 Cells
Purity/Purification
>97% by SDS-PAGE.
Form/Format
Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.
Sequence
SEVGNSQAVCPGTLNGLSVTGDAENQYQTLYKLYERCEVVMGNLEIVLTGHNADLSFLQWIREVTGYVLVAMNEFSTLPLPNLRVVRGTQVYDGKFAIFVMLNYNTNSSHALRQLRLTQLTEILSGGVYIEKNDKLCHMDTIDWRDIVRDRDAEIVVKDNGRSCPPCHEVCKGRCWGPGSEDCQTLTKTICAPQCNGHCFGPNPNQCCHDECAGGCSGPQDTDCFACRHFNDSGACVPRCPQPLVYNKLTFQLEPNPHTKYQYGGVCVASCPHNFVVDQTSCVRACPPDKMEVDKNGLKMCEPCGGLCPKACEGTGSGSRFQTVDSSNIDGFVNCTKILGNLDFLITGLNGDPWHKIPALDPEKLNVFRTVREITGYLNIQSWPPHMHNFSVFSNLTTIGGRSLYNRGFSLLIMKNLNVTSLGFRSLKEISAGRIYISANRQLCYHHSLNWTKVLRGPTEERLDIKHNRPRRDCVAEGKVCDPLCSSGGCWGPGPGQCLSCRNYSRGGVCVTHCNFLNGEPREFAHEAECFSCHPECQPMEGTATCNGSGSDTCAQCAHFRDGPHCVSSCPHGVLGAKGPIYKYPDVQNECRPCHENCTQGCKGPELQDCLGQTLVLIGKTHLT
Sequence Length
183
Species
Human
Endotoxin
< 0.1 EU/ug of the protein by LAL method.
Biological Activity
Measured by its ability to inhibit the biological activity of Neuregulin-1-beta 1 on MCF-7 human breast cancer cells. The ED50 for this effect is typically 1.5-6.0 ug/mL in the presence of 10 ng/mL Recombinant Human NRG1-beta 1/HRG1-beta 1 Extracellular Domain.
Reconstitution
Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water.
Tag
6xHis tag at the C-terminus
Preparation and Storage
Store the lyophilized protein at -20 degree C to -80 degree C for long term.
After reconstitution, the protein solution is stable at -20 degree C for 3 months, at 2-8 degree C for up to 1 week.

SDS-Page

(Recombinant Human ErbB3/Her3 Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at approximately 100 kDa.)

SDS-Page (Recombinant Human ErbB3/Her3 Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at approximately 100 kDa.)
Related Product Information for ErbB3 active protein
Description: Recombinant Human ErbB3/Her3 Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Ser20-Thr643) of human ErbB3/Her3 (Accession #NP_001973.2) fused with a 6xHis tag at the C-terminus.

Background: This protein is a member of the epidermal growth factor receptor (EGFR) family of receptor tyrosine kinases. This membrane-bound protein has a neuregulin binding domain but not an active kinase domain. It therefore can bind this ligand but not convey the signal into the cell through protein phosphorylation. However, it does form heterodimers with other EGF receptor family members which do have kinase activity. Heterodimerization leads to the activation of pathways which lead to cell proliferation or differentiation. Amplification of this gene and/or overexpression of its protein have been reported in numerous cancers, including prostate, bladder, and breast tumors. Alternate transcriptional splice variants encoding different isoforms have been characterized. One isoform lacks the intermembrane region and is secreted outside the cell. This form acts to modulate the activity of the membrane-bound form. Additional splice variants have also been reported, but they have not been thoroughly characterized.
Product Categories/Family for ErbB3 active protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
receptor tyrosine-protein kinase erbB-3 isoform s
NCBI Official Synonym Full Names
erb-b2 receptor tyrosine kinase 3
NCBI Official Symbol
ERBB3
NCBI Official Synonym Symbols
HER3; FERLK; LCCS2; ErbB-3; c-erbB3; erbB3-S; MDA-BF-1; c-erbB-3; p180-ErbB3; p45-sErbB3; p85-sErbB3
NCBI Protein Information
receptor tyrosine-protein kinase erbB-3
UniProt Protein Name
Receptor tyrosine-protein kinase erbB-3
UniProt Gene Name
ERBB3
UniProt Synonym Gene Names
HER3
UniProt Entry Name
ERBB3_HUMAN

NCBI Description

This gene encodes a member of the epidermal growth factor receptor (EGFR) family of receptor tyrosine kinases. This membrane-bound protein has a neuregulin binding domain but not an active kinase domain. It therefore can bind this ligand but not convey the signal into the cell through protein phosphorylation. However, it does form heterodimers with other EGF receptor family members which do have kinase activity. Heterodimerization leads to the activation of pathways which lead to cell proliferation or differentiation. Amplification of this gene and/or overexpression of its protein have been reported in numerous cancers, including prostate, bladder, and breast tumors. Alternate transcriptional splice variants encoding different isoforms have been characterized. One isoform lacks the intermembrane region and is secreted outside the cell. This form acts to modulate the activity of the membrane-bound form. Additional splice variants have also been reported, but they have not been thoroughly characterized. [provided by RefSeq, Jul 2008]

Uniprot Description

HER3: a receptor tyrosine kinase of the EGFR family. Binds and is activated by neuregulins and NTAK. Can form homodimers or ErbB-2/ErbB-3 heterodimers. Kinase domain lacks activity but heterodimerizes with other EGFRs to transduce growth signals. May be required for HER2 activity. Elevated expression in breast and other tumors is indicative of poor outcome. A secreted form is expressed in metastatic prostate cancer Two alternatively spliced isoforms have been described.

Protein type: Oncoprotein; Kinase, protein; Protein kinase, tyrosine (receptor); Protein kinase, TK; Membrane protein, integral; EC 2.7.10.1; TK group; EGFR family

Chromosomal Location of Human Ortholog: 12q13

Cellular Component: extracellular space; basolateral plasma membrane; integral to plasma membrane; apical plasma membrane; plasma membrane; receptor complex; lateral plasma membrane

Molecular Function: identical protein binding; protein binding; transmembrane receptor activity; protein homodimerization activity; protein heterodimerization activity; protein-tyrosine kinase activity; growth factor binding; protein tyrosine kinase activator activity; ATP binding

Biological Process: epidermal growth factor receptor signaling pathway; phosphoinositide 3-kinase cascade; fibroblast growth factor receptor signaling pathway; phosphoinositide-mediated signaling; nerve growth factor receptor signaling pathway; wound healing; heart development; cranial nerve development; negative regulation of cell adhesion; signal transduction; protein amino acid phosphorylation; peripheral nervous system development; negative regulation of signal transduction; regulation of cell proliferation; Schwann cell differentiation; positive regulation of phosphoinositide 3-kinase cascade; neuron apoptosis; innate immune response; negative regulation of secretion; negative regulation of neuron apoptosis; transmembrane receptor protein tyrosine kinase signaling pathway

Disease: Lethal Congenital Contracture Syndrome 2

Research Articles on ErbB3

Similar Products

Product Notes

The ErbB3 erbb3 (Catalog #AAA9139682) is an Active Protein produced from HEK293 Cells and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: SEVGNSQAVC PGTLNGLSVT GDAENQYQTL YKLYERCEVV MGNLEIVLTG HNADLSFLQW IREVTGYVLV AMNEFSTLPL PNLRVVRGTQ VYDGKFAIFV MLNYNTNSSH ALRQLRLTQL TEILSGGVYI EKNDKLCHMD TIDWRDIVRD RDAEIVVKDN GRSCPPCHEV CKGRCWGPGS EDCQTLTKTI CAPQCNGHCF GPNPNQCCHD ECAGGCSGPQ DTDCFACRHF NDSGACVPRC PQPLVYNKLT FQLEPNPHTK YQYGGVCVAS CPHNFVVDQT SCVRACPPDK MEVDKNGLKM CEPCGGLCPK ACEGTGSGSR FQTVDSSNID GFVNCTKILG NLDFLITGLN GDPWHKIPAL DPEKLNVFRT VREITGYLNI QSWPPHMHNF SVFSNLTTIG GRSLYNRGFS LLIMKNLNVT SLGFRSLKEI SAGRIYISAN RQLCYHHSLN WTKVLRGPTE ERLDIKHNRP RRDCVAEGKV CDPLCSSGGC WGPGPGQCLS CRNYSRGGVC VTHCNFLNGE PREFAHEAEC FSCHPECQPM EGTATCNGSG SDTCAQCAHF RDGPHCVSSC PHGVLGAKGP IYKYPDVQNE CRPCHENCTQ GCKGPELQDC LGQTLVLIGK THLT. It is sometimes possible for the material contained within the vial of "ErbB3/Her3, Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.