Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-TSG101 Antibody Titration: 2.5ug/mlELISA Titer: 1:62500Positive Control: NIH/3T3 cell lysate)

Rabbit TSG101 Polyclonal Antibody | anti-TSG101 antibody

TSG101 antibody - middle region

Gene Names
Tsg101; CC2; AI255943
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast
Applications
Western Blot
Purity
Protein A purified
Synonyms
TSG101; Polyclonal Antibody; TSG101 antibody - middle region; anti-TSG101 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: YMPGMPSGISAYPSGYPPNPSGYPGCPYPPAGPYPATTSSQYPSQPPVTT
Sequence Length
391
Applicable Applications for anti-TSG101 antibody
Western Blot (WB)
Homology
Cow: 87%; Dog: 87%; Goat: 87%; Guinea Pig: 93%; Horse: 87%; Human: 93%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Yeast: 79%
Immunogen
The immunogen is a synthetic peptide corresponding to a region of Mouse
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-TSG101 Antibody Titration: 2.5ug/mlELISA Titer: 1:62500Positive Control: NIH/3T3 cell lysate)

Western Blot (WB) (WB Suggested Anti-TSG101 Antibody Titration: 2.5ug/mlELISA Titer: 1:62500Positive Control: NIH/3T3 cell lysate)
Related Product Information for anti-TSG101 antibody
This is a rabbit polyclonal antibody against TSG101. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: TSG101 has a direct role in the control of growth and differentiation in primary epithelial cells. It is required for normal cell function of embryonic and adult tissues but that this gene is not a tumor suppressor for sporadic forms of breast cancer.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
43kDa
NCBI Official Full Name
tumor susceptibility gene 101 protein isoform 1
NCBI Official Synonym Full Names
tumor susceptibility gene 101
NCBI Official Symbol
Tsg101
NCBI Official Synonym Symbols
CC2; AI255943
NCBI Protein Information
tumor susceptibility gene 101 protein
UniProt Protein Name
Tumor susceptibility gene 101 protein
UniProt Gene Name
Tsg101
UniProt Entry Name
TS101_MOUSE

Uniprot Description

TSG101: Component of the ESCRT-I complex, a regulator of vesicular trafficking process. Binds to ubiquitinated cargo proteins and is required for the sorting of endocytic ubiquitinated cargos into multivesicular bodies (MVBs). Mediates the association between the ESCRT-0 and ESCRT-I complex. Required for completion of cytokinesis; the function requires CEP55. May be involved in cell growth and differentiation. Acts as a negative growth regulator. Involved in the budding of many viruses through an interaction with viral proteins that contain a late-budding motif P-[ST]-A-P. This interaction is essential for viral particle budding of numerous retroviruses. Belongs to the ubiquitin-conjugating enzyme family. UEV subfamily. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Cell cycle regulation; Nuclear receptor co-regulator

Cellular Component: membrane; cytoplasm; early endosome; late endosome; plasma membrane; nucleolus; endosome membrane; nucleus; endosome

Molecular Function: ubiquitin binding; protein binding; protein homodimerization activity; ligand-dependent nuclear receptor transcription coactivator activity; ubiquitin protein ligase binding; calcium-dependent protein binding; transcription corepressor activity

Biological Process: protein monoubiquitination; ubiquitin-dependent protein catabolic process via the multivesicular body pathway; viral reproduction; non-lytic virus budding; protein modification process; cell cycle; keratinocyte differentiation; negative regulation of cell proliferation; protein transport; cell division; transport; regulation of growth; endosome to lysosome transport; regulation of cell growth; cell differentiation; negative regulation of transcription, DNA-dependent; cell cycle arrest

Research Articles on TSG101

Similar Products

Product Notes

The TSG101 tsg101 (Catalog #AAA3203812) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TSG101 antibody - middle region reacts with Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast and may cross-react with other species as described in the data sheet. AAA Biotech's TSG101 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the TSG101 tsg101 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: YMPGMPSGIS AYPSGYPPNP SGYPGCPYPP AGPYPATTSS QYPSQPPVTT. It is sometimes possible for the material contained within the vial of "TSG101, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.