Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-Page (Recombinant Human CD147/EMMPRIN/Basigin Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 60-65 kDa.)

CD147/EMMPRIN/Basigin Active Protein | CD147 active protein

Recombinant Human CD147/EMMPRIN/Basigin Protein

Gene Names
BSG; OK; 5F7; TCSF; CD147; EMPRIN; EMMPRIN; SLC7A11
Purity
>95% by SDS-PAGE.
Synonyms
CD147/EMMPRIN/Basigin; Recombinant Human CD147/EMMPRIN/Basigin Protein; 5F7; CD147; EMMPRIN; OK; TCSF; CD147 active protein
Ordering
For Research Use Only!
Host
HEK293 Cells
Purity/Purification
>95% by SDS-PAGE.
Form/Format
Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.
Sequence
TVFTTVEDLGSKILLTCSLNDSATEVTGHRWLKGGVVLKEDALPGQKTEFKVDSDDQWGEYSCVFLPEPMGTANIQLHGPPRVKAVKSSEHINEGETAMLVCKSESVPPVTDWAWYKITDSEDKALMNGSESRFFVSSSQGRSELHIENLNMEADPGQYRCNGTSSKGSDQAIITLRVRSH
Sequence Length
385
Species
Human
Endotoxin
< 0.1 EU/ug of the protein by LAL method.
Biological Activity
Measured by the ability of the immobilized protein to induce active MMP-1 secretion by NHLF human normal lung fibroblasts. The ED50 for this effect is 2-8 ug/mL.
Reconstitution
Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water.
Tag
Fc, 6xHis tag at the C-terminus
Preparation and Storage
Store the lyophilized protein at -20 degree C to -80 degree C for long term.
After reconstitution, the protein solution is stable at -20 degree C for 3 months, at 2-8 degree C for up to 1 week.

SDS-Page

(Recombinant Human CD147/EMMPRIN/Basigin Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 60-65 kDa.)

SDS-Page (Recombinant Human CD147/EMMPRIN/Basigin Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 60-65 kDa.)
Related Product Information for CD147 active protein
Description: Recombinant Human CD147/EMMPRIN/Basigin Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Thr25-His205) of human CD147/EMMPRIN/Basigin (Accession #NP_001719.2) fused with an Fc, 6xHis tag at the C-terminus.

Background: This protein is a plasma membrane protein that is important in spermatogenesis, embryo implantation, neural network formation, and tumor progression. The encoded protein is also a member of the immunoglobulin superfamily. Multiple transcript variants encoding different isoforms have been found for this gene.
Product Categories/Family for CD147 active protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
682
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
basigin isoform 1
NCBI Official Synonym Full Names
basigin (Ok blood group)
NCBI Official Symbol
BSG
NCBI Official Synonym Symbols
OK; 5F7; TCSF; CD147; EMPRIN; EMMPRIN; SLC7A11
NCBI Protein Information
basigin
UniProt Protein Name
Basigin
UniProt Gene Name
BSG
UniProt Synonym Gene Names
EMMPRIN; TCSF
UniProt Entry Name
BASI_HUMAN

NCBI Description

The protein encoded by this gene, basigin, is a plasma membrane protein that is important in spermatogenesis, embryo implantation, neural network formation, and tumor progression. Basigin is also a member of the immunoglobulin superfamily, ubiquitously expressed in various tissues. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, May 2020]

Uniprot Description

BSG: Plays pivotal roles in spermatogenesis, embryo implantation, neural network formation and tumor progression. Stimulates adjacent fibroblasts to produce matrix metalloproteinases (MMPS). May target monocarboxylate transporters SLC16A1, SLC16A3 and SLC16A8 to plasma membranes of retinal pigment epithelium and neural retina. Seems to be a receptor for oligomannosidic glycans. In vitro, promotes outgrowth of astrocytic processes. Enriched on the surface of tumor cells. Up-regulated in gliomas. Its expression levels correlate with malignant potential of the tumor. Forms homooligomers in a cis-dependent manner on the plasma membrane. Forms a complex with MMP1 at the tumor cell surface. Interacts with SLC16A1 and SLC1A3; probably a BSG dimer is associated with a monocarboxylate transporter dimer. Interacts with ATP1B2, MAG and L1CAM. Interacts with AJAP1. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral; Immunoglobulin superfamily

Chromosomal Location of Human Ortholog: 19p13.3

Cellular Component: Golgi membrane; focal adhesion; membrane; mitochondrion; integral to plasma membrane; melanosome; plasma membrane; sarcolemma; acrosomal membrane; lipid raft

Molecular Function: mannose binding; protein binding

Biological Process: response to peptide hormone stimulus; extracellular matrix organization and biogenesis; response to cAMP; decidualization; odontogenesis of dentine-containing teeth; response to mercury ion; cellular metabolic process; extracellular matrix disassembly; cell surface receptor linked signal transduction; blood coagulation; pyruvate metabolic process; leukocyte migration; embryo implantation

Disease: Blood Group--ok

Research Articles on CD147

Similar Products

Product Notes

The CD147 bsg (Catalog #AAA9139701) is an Active Protein produced from HEK293 Cells and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: TVFTTVEDLG SKILLTCSLN DSATEVTGHR WLKGGVVLKE DALPGQKTEF KVDSDDQWGE YSCVFLPEPM GTANIQLHGP PRVKAVKSSE HINEGETAML VCKSESVPPV TDWAWYKITD SEDKALMNGS ESRFFVSSSQ GRSELHIENL NMEADPGQYR CNGTSSKGSD QAIITLRVRS H. It is sometimes possible for the material contained within the vial of "CD147/EMMPRIN/Basigin, Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.