Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Hemagglutinin-esterase (HE) Recombinant Protein | HE recombinant protein

Recombinant Puffinosis coronavirus Hemagglutinin-esterase (HE)

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Hemagglutinin-esterase (HE); Recombinant Puffinosis coronavirus Hemagglutinin-esterase (HE); Recombinant Hemagglutinin-esterase (HE); Hemagglutinin-esterase; HE protein EC= 3.1.1.53; E3 glycoprotein; HE recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
25-439
Sequence
FNEPLNVVSHLSDDWFLFGDSRSDCSYVENNGHPAFDWLDLPQELCHSGKISAKSGNSLFKSFHFTDWYNYTGEGDQVIFYEGVNFSPSHGFKCLAEGDNKRWMGNKARFYALVYKKMAYYRSLSFVNVSYSYGGKAKPTAICKDNTLTLNNPTFISKESNYVDYYYESDANFTLEGCDEFIVPLCVFNGHSRGSSSDPANKYYMDSQMYYNMDTGVFYGFNSTLDVGNTAQNPGLDLTCIYYALTPGNYKAVSLEYLLTIPSKAICLRKPKRFMPVQVVDSRWNNAKHSDNMTAVACQTPYCLFRNTSSGYNGSTHDVHHGGFHFRKLLSGLLYNVSCIAQQGAFFYNNVSSQWPVLGYGQCPTAANIEFIAPVCLYDPLPVILLGVLLGIAVLIIVFLLFYFMTDSGVRLHEA
Sequence Length
439
Species
Puffinosis coronavirus (PV) (Puffinosis virus)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

NCBI GI #
UniProt Accession #
Molecular Weight
49,180 Da
NCBI Official Full Name
Hemagglutinin-esterase
UniProt Protein Name
Hemagglutinin-esterase
Protein Family
UniProt Gene Name
HE
UniProt Synonym Gene Names
HE protein
UniProt Entry Name
HEMA_CVPV

Uniprot Description

Function: Structural protein that makes short spikes at the surface of the virus. Contains receptor binding and receptor-destroying activities. Mediates de-O-acetylation of N-acetyl-4-O-acetylneuraminic acid, which is probably the receptor determinant recognized by the virus on the surface of erythrocytes and susceptible cells. This receptor-destroying activity is important for virus release as it probably helps preventing self-aggregation and ensures the efficient spread of the progeny virus from cell to cell. May serve as a secondary viral attachment protein for initiating infection, the spike protein being the major one. Seems to be a 'luxury' protein that is not absolutely necessary for virus infection in culture. However, its presence in the virus may alter its pathogenicity. May become a target for both the humoral and the cellular branches of the immune system.

Catalytic activity: N-acetyl-O-acetylneuraminate + H2O = N-acetylneuraminate + acetate.

Subunit structure: Homodimer; disulfide-linked. Forms a complex with the M protein in the pre-Golgi. Associates then with S-M complex to form a ternary complex S-M-HE.

Subcellular location: Virion membrane; Single-pass type I membrane protein

Potential. Host cell membrane; Single-pass type I membrane protein

Potential. Note: In infected cells becomes incorporated into the envelope of virions during virus assembly at the endoplasmic reticulum and cis Golgi. However, some may escape incorporation into virions and subsequently migrate to the cell surface

By similarity.

Post-translational modification: N-glycosylated in the RER

By similarity.

Sequence similarities: Belongs to the influenza type C/coronaviruses hemagglutinin-esterase family.

Similar Products

Product Notes

The Hemagglutinin-esterase (HE) he (Catalog #AAA1046901) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 25-439. The amino acid sequence is listed below: FNEPLNVVSH LSDDWFLFGD SRSDCSYVEN NGHPAFDWLD LPQELCHSGK ISAKSGNSLF KSFHFTDWYN YTGEGDQVIF YEGVNFSPSH GFKCLAEGDN KRWMGNKARF YALVYKKMAY YRSLSFVNVS YSYGGKAKPT AICKDNTLTL NNPTFISKES NYVDYYYESD ANFTLEGCDE FIVPLCVFNG HSRGSSSDPA NKYYMDSQMY YNMDTGVFYG FNSTLDVGNT AQNPGLDLTC IYYALTPGNY KAVSLEYLLT IPSKAICLRK PKRFMPVQVV DSRWNNAKHS DNMTAVACQT PYCLFRNTSS GYNGSTHDVH HGGFHFRKLL SGLLYNVSCI AQQGAFFYNN VSSQWPVLGY GQCPTAANIE FIAPVCLYDP LPVILLGVLL GIAVLIIVFL LFYFMTDSGV RLHEA. It is sometimes possible for the material contained within the vial of "Hemagglutinin-esterase (HE), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.