Histone deacetylase 3 (HDAC3) Recombinant Protein | HDAC3 recombinant protein
Recombinant Chicken Histone deacetylase 3 (HDAC3)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Histone deacetylase 3 (HDAC3); Recombinant Chicken Histone deacetylase 3 (HDAC3); HDAC3 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-428, Full length protein
Sequence
MAKTVAYFYDPDVGNFHYGAGHPMKPHRLALTHSLVLHYGLYKKMIVFKPYQASQHDMCRFHSEDYIDFLQRVSPNNMQGFTKSLNAFNVGDDCPVFPGLFEFCSRYTGASLQGATQLNNKICDIAINWAGGLHHAKKFEASGFCYVNDIVIGILELLKYHPRVLYIDIDIHHGDGVQEAFYLTDRVMTVSFHKYGNYFFPGTGDMYEVGAESGRYYALNVPLRDGIDDQSYKHLFQPVINQVVDYYQPTCIVLQCGADSLGRDRLGCFNLSIRGHGECVEYVKSFNIPLLVLGGGGYTVRNVARCWTYETSLLVDEAISEELPYSEYFEYFAPDFTLHPDVSTRIENQNSRQYLDQIRQTIFENLKMLNHAPSVQIHDVPSDLLSYDRTDEPDPEERGSEENYSRPEAANEFYDGDHDNDKESDVEI
Sequence Length
428
Species
Chicken
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for HDAC3 recombinant protein
Histones play a critical role in transcriptional regulation, cell cycle progression, and developmental events. Histone acetylation
deacetylation alters chromosome structure and affects transcription factor access to DNA. This protein belongs to the histone deacetylase
acuc
apha family. It has histone deacetylase activity and represses transcription when tethered to a promoter. It may participate in the regulation of transcription through its binding with the zinc-finger transcription factor YY1. This protein can also down-regulate p53 function and thus modulate cell growth and apoptosis. This gene is regarded as a potential tumor suppressor gene.
deacetylation alters chromosome structure and affects transcription factor access to DNA. This protein belongs to the histone deacetylase
acuc
apha family. It has histone deacetylase activity and represses transcription when tethered to a promoter. It may participate in the regulation of transcription through its binding with the zinc-finger transcription factor YY1. This protein can also down-regulate p53 function and thus modulate cell growth and apoptosis. This gene is regarded as a potential tumor suppressor gene.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
48,902 Da
NCBI Official Full Name
histone deacetylase 3
NCBI Official Synonym Full Names
histone deacetylase 3
NCBI Official Symbol
HDAC3
NCBI Protein Information
histone deacetylase 3
UniProt Protein Name
Histone deacetylase 3
Protein Family
UniProt Gene Name
HDAC3
UniProt Synonym Gene Names
HD3
Uniprot Description
Responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4). Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events. Histone deacetylases act via the formation of large multiprotein complexes ().
Similar Products
Product Notes
The HDAC3 hdac3 (Catalog #AAA948554) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-428, Full length protein. The amino acid sequence is listed below: MAKTVAYFYD PDVGNFHYGA GHPMKPHRLA LTHSLVLHYG LYKKMIVFKP YQASQHDMCR FHSEDYIDFL QRVSPNNMQG FTKSLNAFNV GDDCPVFPGL FEFCSRYTGA SLQGATQLNN KICDIAINWA GGLHHAKKFE ASGFCYVNDI VIGILELLKY HPRVLYIDID IHHGDGVQEA FYLTDRVMTV SFHKYGNYFF PGTGDMYEVG AESGRYYALN VPLRDGIDDQ SYKHLFQPVI NQVVDYYQPT CIVLQCGADS LGRDRLGCFN LSIRGHGECV EYVKSFNIPL LVLGGGGYTV RNVARCWTYE TSLLVDEAIS EELPYSEYFE YFAPDFTLHP DVSTRIENQN SRQYLDQIRQ TIFENLKMLN HAPSVQIHDV PSDLLSYDRT DEPDPEERGS EENYSRPEAA NEFYDGDHDN DKESDVEI. It is sometimes possible for the material contained within the vial of "Histone deacetylase 3 (HDAC3), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
