Hydroxycarboxylic acid receptor 3 (HCAR3) Recombinant Protein | HCAR3 recombinant protein
Recombinant Human Hydroxycarboxylic acid receptor 3 (HCAR3)
Gene Names
HCAR3; HCA3; HM74; PUMAG; Puma-g; GPR109B
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Hydroxycarboxylic acid receptor 3 (HCAR3); Recombinant Human Hydroxycarboxylic acid receptor 3 (HCAR3); Recombinant Hydroxycarboxylic acid receptor 3 (HCAR3); Hydroxycarboxylic acid receptor 3; G-protein coupled receptor 109B G-protein coupled receptor HM74 G-protein coupled receptor HM74B Niacin receptor 2 Nicotinic acid receptor 2; HCAR3 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-387
Sequence
MNRHHLQDHFLEIDKKNCCVFRDDFIAKVLPPVLGLEFIFGLLGNGLALWIFCFHLKSWKSSRIFLFNLAVADFLLIICLPFVMDYYVRRSDWKFGDIPCRLVLFMFAMNRQGSIIFLTVVAVDRYFRVVHPHHALNKISNWTAAIISCLLWGITVGLTVHLLKKKLLIQNGPANVCISFSICHTFRWHEAMFLLEFLLPLGIILFCSARIIWSLRQRQMDRHAKIKRAITFIMVVAIVFVICFLPSVVVRIRIFWLLHTSGTQNCEVYRSVDLAFFITLSFTYMNSMLDPVVYYFSSPSFPNFFSTLINRCLQRKMTGEPDNNRSTSVELTGDPNKTRGAPEALMANSGEPWSPSYLGPTSNNHSKKGHCHQEPASLEKQLGCCIE
Sequence Length
387
Species
Homo sapiens (Human)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
44,496 Da
NCBI Official Full Name
hydroxycarboxylic acid receptor 3
NCBI Official Synonym Full Names
hydroxycarboxylic acid receptor 3
NCBI Official Symbol
HCAR3
NCBI Official Synonym Symbols
HCA3; HM74; PUMAG; Puma-g; GPR109B
NCBI Protein Information
hydroxycarboxylic acid receptor 3; niacin receptor 2; GTP-binding protein; nicotinic acid receptor 2; putative chemokine receptor; G protein-coupled receptor 109B; G-protein coupled receptor 109B; G-protein coupled receptor HM74; G-protein coupled receptor HM74B; hydroxy-carboxylic acid receptor 3
UniProt Protein Name
Hydroxycarboxylic acid receptor 3
Protein Family
UniProt Gene Name
HCAR3
UniProt Synonym Gene Names
GPR109B; HCA3; HM74B; NIACR2
UniProt Entry Name
HCAR3_HUMAN
Uniprot Description
GPR109B: Receptor for 3-OH-octanoid acid mediates a negative feedback regulation of adipocyte lipolysis to counteract prolipolytic influences under conditions of physiological or pathological increases in beta-oxidation rates. Acts as a low affinity receptor for nicotinic acid. This pharmacological effect requires nicotinic acid doses that are much higher than those provided by a normal diet. Belongs to the G-protein coupled receptor 1 family.
Protein type: Membrane protein, multi-pass; Membrane protein, integral; Receptor, GPCR; GPCR, family 1
Chromosomal Location of Human Ortholog: 12q24.31
Cellular Component: integral to plasma membrane; plasma membrane
Molecular Function: G-protein coupled receptor activity
Biological Process: G-protein coupled receptor protein signaling pathway
Research Articles on HCAR3
Similar Products
Product Notes
The HCAR3 hcar3 (Catalog #AAA1060455) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-387. The amino acid sequence is listed below: MNRHHLQDHF LEIDKKNCCV FRDDFIAKVL PPVLGLEFIF GLLGNGLALW IFCFHLKSWK SSRIFLFNLA VADFLLIICL PFVMDYYVRR SDWKFGDIPC RLVLFMFAMN RQGSIIFLTV VAVDRYFRVV HPHHALNKIS NWTAAIISCL LWGITVGLTV HLLKKKLLIQ NGPANVCISF SICHTFRWHE AMFLLEFLLP LGIILFCSAR IIWSLRQRQM DRHAKIKRAI TFIMVVAIVF VICFLPSVVV RIRIFWLLHT SGTQNCEVYR SVDLAFFITL SFTYMNSMLD PVVYYFSSPS FPNFFSTLIN RCLQRKMTGE PDNNRSTSVE LTGDPNKTRG APEALMANSG EPWSPSYLGP TSNNHSKKGH CHQEPASLEK QLGCCIE. It is sometimes possible for the material contained within the vial of "Hydroxycarboxylic acid receptor 3 (HCAR3), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
